KEGG   Acanthamoeba castellanii: ACA1_115400Help
Entry
ACA1_115400       CDS       T02667                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
acan  Acanthamoeba castellanii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acan00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ACA1_115400
Enzymes [BR:acan01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     ACA1_115400
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 508 aa AA seqDB search
MAEKVHRVAVVGGGISGLAACRFVQKRLQDSCSSGSKRIILIEQGQRLGGWLHSLRTPEG
FVFEAGPSSIRTVGSKGRATLRLVDELGLRQHVVPCSSLAIKNRYLYTNGSLLRLPNHPL
KVLGSPLMRSAVFAFLREWTVPRSQQPDESIHSFFTRRFSPVVADTLTDALSIGIFGGRS
QSLSIKSCFPFLHEYEQKYGSIGLGMLREMLASRSGQEKNEKNQNTKTTKNEAAAEEEEE
TDEGYLSPAVQEMQKMQVYSFREGVETLSRALEQKIREDEHTDILLNTAVERMDQERDGT
MSLSLGHGMTVRAEKVISALPSHALAHCLRHHPTLEQDMLKIPFASLALVHLAYTEPLLP
AGVEGFGYLVPAMEKQPILGVQFNSSAFPQQDPQPGCTRFTVMMRVEKGQENRTKDEWQA
IALDSLQRHLRLPPAKTAALASPARVNVSVDLNAIPQYVVGHAALVDSIRGALQRDFPSL
HLVGNSWGGVGVNDCVENAWRTVHRLQL
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaggtgcatcgagtggcggtggtgggcggcggcatatcggggctggcggcc
tgccgcttcgtacagaagcggctgcaggacagctgcagtagcggcagcaagcgcatcatt
ttgatcgagcaaggacagcggctgggcggctggctgcactccctacgcacgcccgagggc
ttcgtcttcgaggccggaccctccagcattcgtacggtgggaagcaaggggcgggcgacg
ctgcgtctggtggacgagctgggcctccgacagcacgtggtgccctgttcttcgctggcc
atcaagaacaggtacctgtacacaaacgggagcctgctgcgcctgcccaaccacccactc
aaggtgctgggctccccgctcatgcgcagcgccgtgttcgccttcctgcgcgaatggacc
gtgccccgatcccagcaacccgatgaatccatccactcgttcttcacgcgtcggttctcc
ccggtggtggccgacaccctcaccgacgccctgagcatcggcattttcggtggtcggtcg
cagagcctgtcgatcaagtcctgcttcccgttcctgcacgaatacgaacaaaagtacggc
tcgatcgggctcggcatgctgcgcgagatgctggcctcgcgatcagggcaggaaaagaac
gaaaagaaccaaaacacgaaaacaacaaagaacgaagcggcggcggaggaggaggaggag
acggacgaggggtacctctcgccggccgttcaagagatgcagaagatgcaggtctactcc
ttccgcgagggcgtcgagaccctgtcgcgcgctctggagcagaagatccgggaagacgag
cacaccgacattctactcaacaccgccgtcgagcgcatggaccaggagcgggatggtacg
atgtcgctcagcctgggacacggcatgacggtgcgagcggagaaggtcatctccgctctg
ccctcccacgccctcgcccactgcctgcgccaccacccgaccctcgagcaagacatgctc
aagattcccttcgcgtcgctggcgctcgtgcacctcgcctacacggaaccgctgctcccg
gcgggtgtggaagggttcggctatctcgtgcccgcgatggagaagcagcccatcctcggc
gtgcagttcaactcctccgcattcccccagcaggatcctcagcccggttgtacgcggttc
acggtgatgatgcgggtggagaagggccaagagaatcgcaccaaggacgagtggcaggcc
atcgcgctggacagcctgcagcgccacctccggctgccgccggccaagaccgcagccctg
gcctcgccggcgcgggtcaacgtgagcgtcgacctcaacgccatcccgcagtacgtcgtg
ggccacgcggcgctggtcgactccatccgcggcgccctgcagcgcgacttcccctcgctc
cacctcgtgggcaactcctggggcggcgtcggcgtcaacgattgcgtggagaacgcctgg
cggaccgtccatcgcctccagctctga

DBGET integrated database retrieval system