KEGG   Acanthamoeba castellanii: ACA1_116430Help
Entry
ACA1_116430       CDS       T02667                                 

Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
acan  Acanthamoeba castellanii
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acan00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ACA1_116430
Enzymes [BR:acan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     ACA1_116430
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 252 aa AA seqDB search
MECERRNAGRLEVILGPMFSGKSTELIRRIRRHTIAKQRCFVIKYAADSRYSKENMATHD
RYLIPHKNKPSIRNLREVKQEAALFDCIGIDEGQFFCDIVPFCELMASLGKIVIVAALDG
TFQRKPFGTVLELIPLAESVSKLSAVCMCCSNDASFTQRLGSETAVEVIGGADKYIAVCR
HCYLTSAASTMAKDDAMLSTQPSKREASSSQQAPSTPTHKRFAKRKSLNSPKKIASPAKR
IAKRRRSQGNIA
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggagtgcgagagaagaaatgccggaaggcttgaggtgattttgggtcccatgttcagc
gggaagagcacggagttgatccgccgcatacggcgacacaccatcgccaagcagcgctgc
ttcgtcatcaagtatgccgccgactcgcgttacagtaaagagaacatggctacccacgac
cggtatctcattccgcacaagaacaagccgtccatccgcaacttgagggaggtgaagcaa
gaagctgcgctcttcgactgtatcggcattgacgagggccagttcttctgtgacatcgtc
cccttctgcgagctgatggctagcctcggaaagatcgtcatcgtggctgcgctcgacggc
accttccagcgcaagcccttcggtaccgtgcttgagctcatccctctcgccgagtccgtc
tcgaagctgtctgccgtgtgcatgtgctgctccaacgacgccagcttcacgcagcgactt
ggttcggagaccgccgtagaggtgatcggaggcgccgacaagtacatcgcggtttgccgt
cactgctacttgaccagcgccgcgtccacgatggccaaggacgatgccatgctctcgacc
cagccgagcaagagggaagcgtcgtcgtctcagcaggctccgtcgacgcccacccacaag
cggttcgccaagcgaaagtcgcttaactcgcccaagaagatcgcgtcgcccgccaagcgg
atcgccaagcgcaggcgctcgcagggcaacatcgcctga

DBGET integrated database retrieval system