KEGG   Acanthamoeba castellanii: ACA1_139550Help
Entry
ACA1_139550       CDS       T02667                                 

Definition
nadph cytochrome P450, putative
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
acan  Acanthamoeba castellanii
Brite
Enzymes [BR:acan01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     ACA1_139550
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 705 aa AA seqDB search
MEPAPATAVVEENEEEASMAFTVVVAIAACVVAAAVYRFFLSPAKPPSSTPAGGGGGSKK
PTVPTNSTGAKAALIKGKEAASKEAEKGVPLRILWGSQTGTAEDFSSQLADEARKHGFAP
RSTDLEDFSAEDLADEKTVIFVAATYGEGEPTDNAKDFYAWLMHDDREPGLLERVNFTVF
GLGNRTYEHYNAIGRAIDRRMEELSAARFYERGEGDDDSSLEEDFAKWKKGLWGPLCRLH
DLPFEGAALETESYDVKARNTLVFVDHASEEGQRALQRFKETGHAVGTTKQGVHDAKNPL
VCQVVVNRELHGSTSERSCRHIEIAVPDNITYEPGDHVGVYANNDPDLVLALAKRLGAEA
DLDRLIALAPAAAAAASSKAKYTMGPVTLRQALLELVDITTPPRKSLLHALVQYARSDAD
SAALKALSAGTDQPAHEPRGLNYAQWIKEDRRTIGEVLEALPSVAVPVGHLLELLPALAP
RYYSISSSPLEHPGRIHITCVVTRFTTRTGRLHHGVCSTHFLRLLPGTAQEEGEERHTVP
LFVRKSQFRLPKSVSTPLIMVGPGTGIAPFRGFIHHRKHLREEGGARGEAVLFFGCRERA
KDFLYEEELNTALASGHLSNVLVAFSREQNEKDRLREHKELVWTLLEEQKAHFYICGDAA
QMAPAVRAAVVDIVAEKLADNDRDQAEAYVARLHEQGRWATDVWF
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atggaaccggcaccagccaccgccgtcgtggaggagaacgaggaggaggcgagcatggcc
ttcacggtcgtcgttgccatcgccgcgtgcgtggtggcagctgccgtctaccgcttcttc
ctctcgcccgccaaaccgccatcatcaacaccggccggcggcggcggaggcagcaaaaag
ccaacggtgccaaccaacagcacaggcgccaaggctgcgctcatcaaggggaaggaggcg
gcctccaaggaagccgagaagggcgtcccattgcgcatcttgtggggatcccagaccggc
accgccgaagatttctcctcgcagctcgccgacgaggcccgcaagcacggcttcgcccct
cgctccaccgatctcgaagacttctctgccgaggacctggccgatgagaagaccgtcatc
ttcgtggcggccacctacggcgagggtgagcccaccgacaacgccaaggacttctacgcg
tggctcatgcacgacgaccgcgagcccggcctgctcgagcgcgtcaacttcaccgtcttc
gggctgggcaatcgcacgtacgagcactacaacgcgatcgggcgggcgatcgaccggcgc
atggaggagctctcggcggcccgcttctacgagcggggcgagggcgacgacgactcgtcc
ctcgaagaggactttgccaagtggaagaagggcctctggggtccgctctgccgcctgcac
gaccttcccttcgagggcgccgccctcgagactgaaagctacgacgtgaaggcgcgcaat
acgctggtcttcgtggatcacgcgagcgaggaggggcagcgcgccctccagcgcttcaag
gaaaccggacacgccgtgggcaccaccaagcagggggtgcacgacgcgaagaacccgctg
gtgtgccaggtggtggtgaacagggagctccacggctccacgtcggagcgctcctgccga
cacatcgagatcgccgtgcccgacaacatcacctacgagcccggcgaccacgtcggcgtc
tacgccaacaacgaccccgacctcgttctcgccctcgccaagcgcctcggcgcggaggcc
gatctggatcgcctgatcgcactcgcgccggcggcggcggcggcggcttcgagcaaggcc
aagtacacgatgggacccgtcacgctgcgccaggccctgctggagctggtcgacatcacc
acgccgccgcgcaagtcgctcctgcacgcgctcgtccagtacgcgcgcagcgacgccgac
agcgccgcgctcaaggccctctccgccggcaccgaccagccggcgcacgagccccgcggc
ctcaactacgcccagtggatcaaggaagaccgccggacgatcggcgaggtgctggaggcg
ctgccgtcggtggcggtgccggtggggcacctgctcgagctgctgccggcgctggcgccg
cgctactactcgatctcgtcgtcgccgctggagcaccccggccgcatccacatcacgtgc
gtcgtcacccgcttcaccacccgcacgggccgcctccaccacggcgtctgctccacccac
ttccttcgcctcctgcccggcaccgcccaagaagagggagaggagaggcacacggtgccg
ctgttcgtgcggaaatcgcagttccggctgcccaagtcggtcagcacgcccctcatcatg
gtcggacccggcaccggcatcgcccccttccgcggcttcatccaccacaggaagcacctg
cgcgaggagggcggcgcgcggggcgaggcggtgctgttcttcgggtgcagggagcgggcc
aaggacttcctctacgaggaggagctcaacacggccctcgcctccggccacctctccaac
gtcctcgtcgccttctcgcgcgagcaaaacgaaaaggatcggttgcgtgagcacaaggag
ctcgtctggacgctgctggaagagcagaaggcccatttttacatctgcggtgacgccgcg
cagatggctccggcggtgcgggcggccgtggtggacatcgtggcggagaagctcgccgac
aacgaccgggaccaggccgaggcctacgtcgcgcgcctgcacgagcagggccggtgggcc
accgacgtgtggttctga

DBGET integrated database retrieval system