KEGG   Acanthamoeba castellanii: ACA1_146430Help
Entry
ACA1_146430       CDS       T02667                                 

Definition
catalase
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
acan  Acanthamoeba castellanii
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Peroxisome
Brite
KEGG Orthology (KO) [BR:acan00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ACA1_146430
  Amino acid metabolism
   00380 Tryptophan metabolism
    ACA1_146430
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    ACA1_146430
Enzymes [BR:acan01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     ACA1_146430
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 537 aa AA seqDB search
METAKDIIKGEEPTALEKMASGITADGPGATRVPKCPVMGPLGPNLMTTSVGQPLPDMRT
SLNIGGYVLASDVHLMEKQQTFNRSKICERMVHACGMGAFGYFEVTKDVSRYTKAKFLES
VGKQTPVFARFSTVTYGREFPDSARNPRGFAVKFYTEEGNYDLVGLNFPIFFARDPALGP
DVIRSQTRDAENFLLNFDALFDFLINVPESLHCATMFFSNRGTPYGFRHMEGYGCHTFKW
VNADGEEHYIKYHFLPEAGVRNFTNAEATAMCGLDPDFAKRDLWQHINKGGEVVWKAYIQ
IMTPEQASTCPYDPFDVTKVWSHDDFPLYEYGRLVLNRNVDNYHRDVEQAAFSPGSLVPG
IEPSPDPLLQFRCFFYRDTQYYRLARFVNPQQIPVNCPFAAKVNHPQSRDGLMRTDYNGE
GEPTIYPNSRNGPMGDAKYNWKPVPVTGVIDRASSSRHAGTDSEYDQARELFTKIMSDAE
RMHLFNNIAEFLKLANPDIQEKTIMAFGKVHADYAQGIRKALAAASIPPTPAGHADI
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggagaccgccaaggatatcatcaagggcgaagagcccaccgctctcgagaagatggcc
agcgggatcaccgccgacggccctggtgccacgcgagtgcccaagtgtcccgtcatgggt
ccgctgggtcccaacctgatgacgaccagtgtcggtcagccgctgccagacatgcgcaca
tctctgaacatcggcggctacgtgctggcctccgatgtccacctcatggagaagcagcag
accttcaacaggtccaagatctgcgagcgcatggtacacgcgtgtggcatgggcgctttc
ggttacttcgaggtcaccaaggacgtgagccgctacaccaaggccaagttcttggaatcg
gtgggcaagcagacgccggtgttcgcacgcttcagcactgtcacctacggcagggagttt
cccgactcggcccgtaaccctcggggcttcgccgtcaagttctacaccgaggagggcaac
tacgatctcgtgggtttgaacttcccgatcttcttcgcgcgcgatccggccctgggaccc
gacgttatccgctcgcagacccgcgatgccgagaacttcctgctcaacttcgacgctctc
ttcgacttcctcatcaatgtccccgagtctcttcactgcgccaccatgttcttctccaac
cgcggcactccctacggcttccgccacatggagggctacggttgccacaccttcaagtgg
gtcaacgccgacggcgaggagcactacatcaagtatcacttcctcccggaggcaggcgtg
cgcaacttcaccaacgccgaggcgacggccatgtgcggtctcgatccggactttgccaag
cgcgatctgtggcaacacatcaacaagggcggcgaggtcgtgtggaaggcctatatccag
atcatgactcccgaacaagctagcacctgcccctacgacccctttgatgtgaccaaggtg
tggtcccatgacgacttccctctctacgagtacggccgccttgttctcaaccgcaacgtc
gacaactaccaccgcgatgtcgagcaggcagccttttcgcctggttcgcttgttccgggc
atcgagccgtcgcctgatccgctgcttcagttcaggtgcttcttctaccgggacacgcag
tactaccgcttggctcgttttgtgaacccccaacagatccctgtgaactgcccgttcgcg
gccaaggtcaaccacccgcagagccgcgatggacttatgcgcacggactacaacggcgaa
ggcgagcctaccatctaccccaacagccgaaatggcccaatgggagatgccaagtacaac
tggaagccagtgccagtgactggtgtcattgaccgcgctagcagctcgcgtcatgccggc
accgactcagagtatgaccaggcacgtgagctcttcaccaagatcatgagcgacgccgag
aggatgcacctgttcaacaatatcgccgagttcctcaagctcgccaaccccgacattcag
gaaaagaccatcatggcctttggcaaggtccacgctgactatgcccagggcatccgcaaa
gcccttgcagcagcctccatcccaccaactcccgctggccacgctgacatctga

DBGET integrated database retrieval system