KEGG   Acanthamoeba castellanii: ACA1_149830Help
Entry
ACA1_149830       CDS       T02667                                 

Definition
(RefSeq) protein disulfideisomerase domain containing protein
Organism
acan  Acanthamoeba castellanii
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Unknown
AA seq 276 aa AA seqDB search
MKSSLCLLAFFAVFLLAGATDVDDSDVVVLNAQNFDAQTAEGTWMIEFYAPWCGHCKTLK
PTWAQLATASKGKFNVAMVDGSAEQGLSKRFGIRGFPTIKLIRDGKLYDYNLRRTVEDFT
AFAEGAYAKVEAKELPAAAPATPAPTAAAEASVEESGDAAKKAAVILTTDNFDELTQSGD
WLVEFYAPWCGHCKRLAPVWDQLASEADESLHVGKVDCTTNNPVCSRFAVRGYPTIKLLQ
NGQPKDYSGARTVEAFLTFYRNAKTATTTPEKKDEL
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagttcgctttgcctcctcgccttcttcgcggtgttcctcctcgcgggtgctacc
gacgtcgatgactccgatgttgtcgtgctcaacgcccaaaacttcgacgcccaaacggcc
gaaggcacctggatgatcgagttctatgcgccgtggtgcggccactgcaagacgctcaag
cccacgtgggcccagttggccacggcgagcaagggcaagttcaacgtcgccatggtcgac
ggcagcgcagagcagggcctgtccaagcgcttcggcatccgcggtttccccaccatcaag
ctcattcgcgatggcaagctgtatgactacaaccttcgccgcaccgtcgaagacttcacc
gccttcgccgagggtgcctacgccaaggtcgaggccaaggagctccctgccgccgccccg
gccactccggcccctactgccgccgccgaggcctccgtggaagagtcgggcgacgcggct
aagaaggccgcggtcattctcaccaccgacaacttcgacgagctgacccagtctggcgac
tggctcgtggaattctatgccccgtggtgcggccactgcaagcgcctggcgcccgtctgg
gaccagctcgccagcgaggccgacgagtccctccacgtcggcaaggtcgactgcaccacc
aacaaccctgtgtgcagccgtttcgccgtgcggggctaccccaccatcaagctgttgcag
aacgggcagccgaaggactacagcggagcgcgcacagtggaggctttcctcaccttctat
cgcaacgccaagaccgccaccaccacccccgaaaagaaggacgagctctaa

DBGET integrated database retrieval system