KEGG   Acanthamoeba castellanii: ACA1_155440Help
Entry
ACA1_155440       CDS       T02667                                 

Definition
phosphoinositide 3kinase family, accessory domain (pik domain) domain containing protein
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
acan  Acanthamoeba castellanii
Pathway
Inositol phosphate metabolism
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:acan00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    ACA1_155440
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    ACA1_155440
Enzymes [BR:acan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     ACA1_155440
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 1637 aa AA seqDB search
MAHTVRIKDHILSEDPTIGQTQSRQYRLKIVDTGDVIKAGSERLSQCLSPKLLNQQSEIT
VCFLKRVSTMDALRASTMRERPRVMTSAAETVPPPKERKGIFKKRHPTLMGGSTASPTSP
TSSLHQSSVQLGSHNNNTSTTNNINNTTTGSGSGQTRSEDRRDTLVKSTSALVMGSAAGS
PRQPLRARPTEHSWGSAKRRSNGCSNIMLGAQKWQAAAPAVPAENKGHSFLRESSAGRMA
APTVAASSGTSGGEGAQRVGAPRELVVEEDKTGSGSEPLDSEDDASVRSQCLSESKESDE
EATSSAAAESEIIDFSERESGTETTDRSEAGSDSDVEDLFNYDYENEDMAESAEEEAQLD
EAEAEADGAFESDESGDGGASPDLSRRRSLGSARLSKPPTARSPSVGRIARRSNSIVGRG
EAGADREKLLQTSATSLSASHAAAKTATDRPVMRRRQTTHTQFKIKHAATLREFQSKPKT
VPLRLRYDGQEVLLHFSATDTVEAFIGLAVNTIKGAVMSATALELVMENEQVLNPTDMLA
RHPYIAEAVENKGLSEGVRRTGSIADLLFARRKDPGTAEKKWDYELRVIMPDGSTRMVQC
MYRDTPKNLKEALQDPDKPLLHLKNVGFRLPDGNKDGICLSDDLALAKLAQISQCLFNNE
VPTVLFVERDREAVKQDDMRRLEIGSLVGKPLCWAQEQDEVTVFRESACRQRYLERQERL
RSIEAGGVPIQRSEVEGPVQLPPIFIAPPLFADPAGVKKGFAVKGDMTATALLEEAHRKM
IARKLPDTSAQDFILQVAGTKDYIDGPYPVHSFKYLRQCLTTNERPNMVMIERKCVAMEK
PLPAEDPMDAEELVDPTFRHDHKLLSMESRPWHELSCFSLWDMNRAFRVRIVGVEKINPN
TTSFQKASGKTDITEANLGLFVTVGCYHGGALISPLVRTNVQQCSRNPRWFEWVNFEIPT
CNIPHAARLCFTLWAARTSPFKEIPLGWVACQLFDYKNELKTGLMTLNLWHNEEANPIGT
CGSNTSAEMPLFVEFDQYALPVVFPTEPLFTDRVPPSYFASASGGVASPFRKSCEVSPRS
PRWSSPAKSSPMAKKRLVDDAAVPESIPAKIDRILSQDPLYLLKPDEKMLLWDHRYHLLS
KPKALPKFLLSITYQDRYQVQEMHHLLAKWPHFPNPVDALELLDAKFADAAVRQYAVECL
DELSNEQLGDYLLQLVQVLKYELYHDSALSRFLLRRALRSKELGHMLYWYLKSEVHVPTI
AERYELLLEAYLRGCGSHRAELKKQEDVHKEMARIAYRIKEIKEAEKKKETLQEELKRFG
ERLEKTPALTPFQLPLDYKRQAKGVLIHKCKYMDSKKKPLWLVWENADATQPPIYTIFKA
GDDLRQDMLTLQMLRIMDKLWKSEGLDLKLSPYGCVSTGHELGMIEVVTQSETTANISSA
AAGVKGAFAVDPIANWLAAKNKNGKYRRAVENFISSCAGYCVATYVLGIGDRHNDNIMLN
ESGLLFHIDFGHFLGNYKKKLGIKREKAPFVLTPDFAYVMGGRDSKDFKTFCDKCCKGYN
ILRKHSNMFINLFCMMLSTGIPELTSPNDIQYLRTALCLSLTDEEAAEEFQKLIYESLDT
KTTQWNNLAHMIVHRKK
NT seq 4914 nt NT seq  +upstreamnt  +downstreamnt
atggcccacacggttcgcatcaaggatcacatcctcagcgaggatccgaccattgggcag
acccagtcgcgacagtatcgcctcaagattgtcgacaccggcgatgtgatcaaggccggc
agcgagcgcctgtcgcagtgcctgtctccaaagctcctcaaccagcagtcggagatcacc
gtatgcttcctcaagcgcgtttccaccatggacgccctgcgagcctccacgatgcgggag
cggccccgggtgatgacgagcgcagcggagacggtgcccccgcccaaggagcgcaagggg
atattcaagaagaggcatcccacgctgatgggcgggagcacggcttcgccgacctcgccg
acttcttcgctgcatcagtcctccgtccagctcggcagccacaacaacaacacctccacc
accaataacatcaacaacactaccaccggcagcggaagcggtcagacgaggagtgaagac
cgcagggatacgctggtcaagagcacctcagcgctggtcatgggctcggccgccggctct
cctcgacagcccctccgcgctcggcccaccgagcactcctggggctcggccaaacggaga
tcgaacgggtgctcgaacatcatgctgggcgcgcagaagtggcaggccgcggcgccggcg
gtgccggcagagaataagggacactcgttcctgcgggaaagctcggcgggccgcatggct
gcaccaactgttgccgccagctctgggacgagcggcggcgagggagctcagcgtgttggt
gcgcccagggagctggtggtggaggaggacaagaccgggagtggcagcgagccgctcgac
agcgaagacgacgcgtcggtcaggtcgcagtgcctgagcgagagcaaggagagcgacgag
gaggccaccagcagcgcggcggctgagtcggagattattgatttcagcgaacgggagagc
ggcacagaaaccaccgacagaagcgaggcaggcagcgacagcgatgtcgaggatctgttc
aactacgactacgagaacgaggacatggctgagtccgccgaggaggaggcccagctcgat
gaggccgaggctgaggccgacggcgccttcgaaagcgatgagtcgggcgacggcggcgcc
tcgcccgatctcagcaggcggcggtccctgggatccgcaaggctgagcaagcccccgacg
gcgcggtcgcccagcgtggggcggatagcgcggcggtccaacagcatcgtggggcgcggg
gaggctggggccgaccgcgagaagctgctgcagacatcggcgacctctctgtcggcctcg
cacgccgccgccaagaccgcgaccgaccggccggtcatgcgccgccgacagaccacccac
acgcagttcaagatcaagcacgcagccacgctgcgcgagttccagtcgaagcccaagacc
gtgcccctgcggctgcgctacgacggacaggaagtgctgttgcacttctcggccacggac
accgtcgaagcgttcatcggactcgctgtaaatacgatcaagggtgcggtgatgtcggcg
actgcgctggagttggtgatggagaacgagcaggtcctgaatcccaccgatatgttggcc
aggcacccctacatcgccgaagcggtggagaacaagggactgagcgagggagtgcgacgg
acaggctcaatcgccgacctcctcttcgcgagaaggaaggaccctggcacggcggaaaag
aaatgggactacgagttgagggtcatcatgccggacgggagcacgcgcatggtgcagtgc
atgtacagggacacgcccaagaacctcaaggaggccctgcaggaccccgacaagccgctg
ctgcacctcaagaacgtcggcttccgcctacccgacggcaacaaggacggcatctgcctg
agcgacgacctcgcactggccaagctggcacagatcagccagtgcctgttcaacaacgag
gtgcccacggtgctgtttgtcgagcgcgatcgcgaggccgtgaagcaggacgacatgcga
cggctggagatcgggagcctggtgggcaagccgctgtgctgggcgcaggagcaggacgaa
gtcaccgtgttccgcgagagcgcgtgtcgccagcgctacctggagcggcaggagcggctg
cgcagcatcgaagccggcggcgtgcccatccaacgctcagaagtcgagggaccggtgcaa
ctgccgccgatcttcatcgccccgcccctgttcgcggaccctgctggcgtcaagaagggg
tttgctgtgaaaggtgatatgacggccacggcgctgctggaggaggcgcatcgaaagatg
atcgcgcgcaagctgccggacacgtcggcccaggacttcatattgcaggtggcgggcacg
aaggactacatcgacggcccctaccccgtgcactccttcaagtacctgcgccagtgcctc
accaccaacgaacggcccaacatggtgatgatagagcggaagtgcgtggccatggagaag
cctctgccggccgaagaccccatggacgccgaggagctggtggaccccaccttccgacac
gaccacaagctgctgagcatggagtcgaggccgtggcacgagctctcctgcttctccctg
tgggacatgaacagggcgttccgggtgcgcatcgtgggcgtggagaagatcaaccccaac
accacctccttccagaaggcatcgggcaagaccgacatcaccgaagccaatttgggcctg
ttcgtcaccgttggctgttaccacggcggcgcgctcatcagtccgctcgtcagaaccaac
gtgcaacagtgctcgcgcaacccgcggtggttcgagtgggtcaacttcgagatccccacg
tgcaacatcccgcacgccgcccggctgtgcttcactctctgggccgcgcgcacttctccg
tttaaggagattccgctgggttgggtcgcgtgtcagctgttcgactacaagaacgagctg
aagacgggcctgatgaccctcaacctgtggcacaacgaggaggccaacccgatcggcacc
tgcgggtccaacacgtcggcggagatgcccctctttgtcgagttcgaccagtacgccctg
ccggtggttttccccaccgaaccgctcttcaccgaccgcgtgcctccgtcctactttgcc
tccgcctccggcggcgtggcctcgcccttccgcaagtcttgcgaagtcagcccgcgcagc
ccccgatggtcatctccagccaaatcgtcgccgatggcgaagaagcggctggtcgacgac
gccgcggtgccggagtcgataccggccaagatcgaccggatactgagccaggacccactc
tacctgctcaagcccgacgaaaagatgctgctgtgggaccaccggtaccacctgctctcc
aagcccaaggccctgcccaagttcctgctctccatcacctaccaggaccgataccaagtg
caagagatgcaccacctgctcgccaagtggccgcacttccccaacccggtggacgcgctc
gagctgctggacgccaagttcgccgacgctgcggtgcggcagtacgccgtcgagtgcctc
gacgagctctccaacgaacagctcggcgactacctgctccagctcgttcaggtgctcaag
tacgagctctaccacgacagcgccctgtcgcgattcctcctgcggcgcgccctgcggagc
aaggagctgggccacatgctctactggtacctcaagtcggaggtgcacgtgcccacgatc
gccgagcgctacgagctcctgctcgaggcctacctccgcggctgcggctcgcaccgggcc
gagctcaagaagcaagaggacgtccacaaagagatggcgcgcatagcgtaccggatcaag
gaaattaaggaggcggaaaagaagaaggagacgctgcaggaggagctgaagcggttcggc
gagcggctcgagaagacgcccgcgctgacgcccttccagctgccgctcgactacaagcgg
caggccaagggggtcctcatccacaagtgcaagtacatggactccaaaaagaaaccgctg
tggctggtgtgggagaatgcggacgcgacgcagccgccgatctacacgatcttcaaggcc
ggcgatgacctgcggcaggacatgctgaccctccagatgctcaggatcatggacaagttg
tggaagtcggaggggctggacctcaagttgtcgccctacggctgcgtgtcgacggggcac
gagctgggcatgatcgaagtcgtcacccagtccgaaaccaccgccaacatctcctccgcg
gcggcgggagtgaagggagcgtttgcggtggacccaatagcgaactggctggcggccaag
aacaagaacggcaaataccggcgggccgtggagaacttcatctcctcgtgcgccgggtac
tgcgtggccacctacgtgctgggcatcggcgatcgacacaacgacaacatcatgctcaac
gagtccgggctgctcttccatatcgattttgggcacttcttgggaaactacaagaagaag
ctggggatcaagagggaaaaggcgccgttcgtgctcacgcccgactttgcgtacgtgatg
ggcggccgcgactcgaaggacttcaagaccttctgcgacaagtgctgcaagggctacaac
atcctgcgaaagcactccaacatgttcatcaaccttttttgtatgatgttgtcgaccggc
attccagagctgacgtcgcccaacgacatccagtacctgcgcacggccctctgcctgtcg
ctgaccgatgaggaggcggccgaggagttccagaagctcatctacgagagcctcgacacc
aagaccacccagtggaacaacctggcccacatgatcgtacaccggaagaagtga

DBGET integrated database retrieval system