KEGG   Acanthamoeba castellanii: ACA1_164050Help
Entry
ACA1_164050       CDS       T02667                                 

Definition
Antiquitin, putative
Orthology
K14085  
aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
acan  Acanthamoeba castellanii
Pathway
Glycolysis / Gluconeogenesis
Ascorbate and aldarate metabolism
Fatty acid degradation
Glycine, serine and threonine metabolism
Valine, leucine and isoleucine degradation
Lysine biosynthesis
Lysine degradation
Arginine and proline metabolism
Histidine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Glycerolipid metabolism
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:acan01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:acan00010]
Metabolism; Carbohydrate metabolism; Ascorbate and aldarate metabolism [PATH:acan00053]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:acan00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:acan00640]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:acan00071]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:acan00561]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:acan00260]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:acan00280]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:acan00300]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:acan00310]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:acan00330]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:acan00340]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:acan00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:acan00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 556 aa AA seqDB search
MKRLSCASKQFVVPSRASLHLQGRRGLATGGSQYAKHARFLQSLGIEEGVNDGVCIDGKW
SKGSGEVVDSVNPAYNETITRVATAGLKDYERAIEATKSVEKMWAEVPAPKRGEIVRQIG
DELRKHLEDLGALVSLEVGKITQEGIGEVQEFVDVCDYAVGLSRSFSGQIFPSERPNHYM
LEQWNPIGTTGIITAFNFPVAVMGWNAALALVCGNPLIWKGAPSTNLCTLATQRIIQRVL
ERNGMPGSICVALTGGAEIGEAISKDPRVPLVSFTGSTQVGKIVATQVASRMGRSLLELG
GNNAITVLDDADLTLAVRSILFAAVGTAGQRCTTARRLFLHEKIHDDWARRWATRSRRTL
SSGPLHRPSSVDLYKNAVAKAQEQGGKIITGGKVKTDRPGNFVEPTIVSIKHDAPIALHE
TFAPILYVSKVPDLDTAIRYNNEVAQGLSSSLFTTNQQNVFKWIGPSGSDCGIVNVNIPT
NGAEIGGAFGGNKETGGGRESGSDSWKQYMRRSTWYGHLLPSPKSSYVEFITTHHNHNST
INYGKELPLAQGIKFD
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgaagaggttgagctgtgcatcgaagcaatttgtggtgccctcgcgggcctcccttcac
ctgcagggccgccgcggccttgccactggtggcagccaatacgccaagcacgcccgcttc
ctgcaatcgctgggcatcgaggagggggtcaacgatggcgtgtgcatcgatggcaagtgg
agcaagggcagcggcgaggtcgtcgactccgtcaacccggcctacaacgagaccatcact
cgcgtcgccaccgcggggctgaaggactacgagcgcgccatcgaggctaccaagagcgtt
gagaagatgtgggccgaggtgcctgcccccaagcgaggagagatcgtccgacagatcggt
gacgagctgaggaagcacctcgaggacttgggcgcgctggtctcgctcgaggtgggcaag
atcacccaggagggcatcggcgaggtgcaggagttcgtcgacgtctgcgactacgccgtc
ggtctctcccgctccttctccggtcagatcttcccgtcggagcgcccgaaccactacatg
cttgagcagtggaaccccatcggcaccacgggcatcatcaccgccttcaacttccctgtt
gccgtcatgggctggaatgcggcgcttgctctcgtttgcggtaacccgctgatctggaag
ggcgcaccctcgaccaacctgtgcacgctggccacccagcgcatcatccagcgcgtactg
gagcgcaacggcatgcccggctccatctgcgtggccctgaccggcggcgccgagatcggt
gaggccatctccaaggacccgcgcgtgccgctcgtctccttcactggcagcacccaggtg
ggcaagatcgtggcgacccaggtcgcgtctcgcatgggccgcagcctgctcgagctgggc
ggcaacaacgccatcaccgtgcttgatgatgccgacctcactctggctgtccgcagcatc
ctgttcgccgccgtgggtaccgctggccagcgctgcacgaccgctcgccgattgttcctg
cacgagaagatccacgacgattgggccagaagatgggcgacccgctcgagaagaacactc
tcctcgggtcccctccaccgcccctcctccgtcgacctctacaagaacgccgtcgccaag
gcgcaggagcagggcggcaagatcatcaccggcggtaaggtgaagaccgacaggcccggc
aacttcgtggagcccaccatcgtgtcgatcaagcacgacgcccccatcgccctccacgag
accttcgcgcccatcctctatgtctctaaagttcccgaccttgacacggccattcgttac
aacaacgaggtggcgcaggggctcagcagctcgctgttcaccaccaaccagcagaacgtc
ttcaagtggatcggacccagcggatcggattgcggtatcgtgaacgtgaacatcccgacc
aacggcgccgagatcggaggcgccttcggtggcaacaaggagaccggcggcggtcgcgag
tccggctccgactcctggaagcagtacatgcgcaggtccacctggtacggtcaccttctg
ccctcccctaagagctcttatgtggagttcatcaccactcaccacaaccacaacagcacg
atcaactacggcaaggagcttcctctggcgcagggcatcaagtttgactag

DBGET integrated database retrieval system