KEGG   Acanthamoeba castellanii: ACA1_164050Help
Entry
ACA1_164050       CDS       T02667                                 

Definition
(RefSeq) Antiquitin, putative
  KO
K14085  
aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
acan  Acanthamoeba castellanii
Pathway
Glycolysis / Gluconeogenesis
Ascorbate and aldarate metabolism
Fatty acid degradation
Glycine, serine and threonine metabolism
Valine, leucine and isoleucine degradation
Lysine degradation
Arginine and proline metabolism
Histidine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Glycerolipid metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:acan00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACA1_164050
   00053 Ascorbate and aldarate metabolism
    ACA1_164050
   00620 Pyruvate metabolism
    ACA1_164050
  Lipid metabolism
   00071 Fatty acid degradation
    ACA1_164050
   00561 Glycerolipid metabolism
    ACA1_164050
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ACA1_164050
   00280 Valine, leucine and isoleucine degradation
    ACA1_164050
   00310 Lysine degradation
    ACA1_164050
   00330 Arginine and proline metabolism
    ACA1_164050
   00340 Histidine metabolism
    ACA1_164050
   00380 Tryptophan metabolism
    ACA1_164050
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ACA1_164050
Enzymes [BR:acan01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     ACA1_164050
    1.2.1.8  betaine-aldehyde dehydrogenase
     ACA1_164050
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     ACA1_164050
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Unknown
AA seq 556 aa AA seqDB search
MKRLSCASKQFVVPSRASLHLQGRRGLATGGSQYAKHARFLQSLGIEEGVNDGVCIDGKW
SKGSGEVVDSVNPAYNETITRVATAGLKDYERAIEATKSVEKMWAEVPAPKRGEIVRQIG
DELRKHLEDLGALVSLEVGKITQEGIGEVQEFVDVCDYAVGLSRSFSGQIFPSERPNHYM
LEQWNPIGTTGIITAFNFPVAVMGWNAALALVCGNPLIWKGAPSTNLCTLATQRIIQRVL
ERNGMPGSICVALTGGAEIGEAISKDPRVPLVSFTGSTQVGKIVATQVASRMGRSLLELG
GNNAITVLDDADLTLAVRSILFAAVGTAGQRCTTARRLFLHEKIHDDWARRWATRSRRTL
SSGPLHRPSSVDLYKNAVAKAQEQGGKIITGGKVKTDRPGNFVEPTIVSIKHDAPIALHE
TFAPILYVSKVPDLDTAIRYNNEVAQGLSSSLFTTNQQNVFKWIGPSGSDCGIVNVNIPT
NGAEIGGAFGGNKETGGGRESGSDSWKQYMRRSTWYGHLLPSPKSSYVEFITTHHNHNST
INYGKELPLAQGIKFD
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgaagaggttgagctgtgcatcgaagcaatttgtggtgccctcgcgggcctcccttcac
ctgcagggccgccgcggccttgccactggtggcagccaatacgccaagcacgcccgcttc
ctgcaatcgctgggcatcgaggagggggtcaacgatggcgtgtgcatcgatggcaagtgg
agcaagggcagcggcgaggtcgtcgactccgtcaacccggcctacaacgagaccatcact
cgcgtcgccaccgcggggctgaaggactacgagcgcgccatcgaggctaccaagagcgtt
gagaagatgtgggccgaggtgcctgcccccaagcgaggagagatcgtccgacagatcggt
gacgagctgaggaagcacctcgaggacttgggcgcgctggtctcgctcgaggtgggcaag
atcacccaggagggcatcggcgaggtgcaggagttcgtcgacgtctgcgactacgccgtc
ggtctctcccgctccttctccggtcagatcttcccgtcggagcgcccgaaccactacatg
cttgagcagtggaaccccatcggcaccacgggcatcatcaccgccttcaacttccctgtt
gccgtcatgggctggaatgcggcgcttgctctcgtttgcggtaacccgctgatctggaag
ggcgcaccctcgaccaacctgtgcacgctggccacccagcgcatcatccagcgcgtactg
gagcgcaacggcatgcccggctccatctgcgtggccctgaccggcggcgccgagatcggt
gaggccatctccaaggacccgcgcgtgccgctcgtctccttcactggcagcacccaggtg
ggcaagatcgtggcgacccaggtcgcgtctcgcatgggccgcagcctgctcgagctgggc
ggcaacaacgccatcaccgtgcttgatgatgccgacctcactctggctgtccgcagcatc
ctgttcgccgccgtgggtaccgctggccagcgctgcacgaccgctcgccgattgttcctg
cacgagaagatccacgacgattgggccagaagatgggcgacccgctcgagaagaacactc
tcctcgggtcccctccaccgcccctcctccgtcgacctctacaagaacgccgtcgccaag
gcgcaggagcagggcggcaagatcatcaccggcggtaaggtgaagaccgacaggcccggc
aacttcgtggagcccaccatcgtgtcgatcaagcacgacgcccccatcgccctccacgag
accttcgcgcccatcctctatgtctctaaagttcccgaccttgacacggccattcgttac
aacaacgaggtggcgcaggggctcagcagctcgctgttcaccaccaaccagcagaacgtc
ttcaagtggatcggacccagcggatcggattgcggtatcgtgaacgtgaacatcccgacc
aacggcgccgagatcggaggcgccttcggtggcaacaaggagaccggcggcggtcgcgag
tccggctccgactcctggaagcagtacatgcgcaggtccacctggtacggtcaccttctg
ccctcccctaagagctcttatgtggagttcatcaccactcaccacaaccacaacagcacg
atcaactacggcaaggagcttcctctggcgcagggcatcaagtttgactag

DBGET integrated database retrieval system