KEGG   Acanthamoeba castellanii: ACA1_164050Help
Entry
ACA1_164050       CDS       T02667                                 

Definition
Antiquitin, putative
Orthology
K14085  
aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
acan  Acanthamoeba castellanii
Pathway
Glycolysis / Gluconeogenesis
Ascorbate and aldarate metabolism
Fatty acid degradation
Glycine, serine and threonine metabolism
Valine, leucine and isoleucine degradation
Lysine biosynthesis
Lysine degradation
Arginine and proline metabolism
Histidine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Glycerolipid metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:acan00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ACA1_164050
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACA1_164050
   00053 Ascorbate and aldarate metabolism
    ACA1_164050
   00620 Pyruvate metabolism
    ACA1_164050
  Lipid metabolism
   00071 Fatty acid degradation
    ACA1_164050
   00561 Glycerolipid metabolism
    ACA1_164050
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ACA1_164050
   00280 Valine, leucine and isoleucine degradation
    ACA1_164050
   00300 Lysine biosynthesis
    ACA1_164050
   00310 Lysine degradation
    ACA1_164050
   00330 Arginine and proline metabolism
    ACA1_164050
   00340 Histidine metabolism
    ACA1_164050
   00380 Tryptophan metabolism
    ACA1_164050
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ACA1_164050
Enzymes [BR:acan01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     ACA1_164050
    1.2.1.8  betaine-aldehyde dehydrogenase
     ACA1_164050
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     ACA1_164050
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 556 aa AA seqDB search
MKRLSCASKQFVVPSRASLHLQGRRGLATGGSQYAKHARFLQSLGIEEGVNDGVCIDGKW
SKGSGEVVDSVNPAYNETITRVATAGLKDYERAIEATKSVEKMWAEVPAPKRGEIVRQIG
DELRKHLEDLGALVSLEVGKITQEGIGEVQEFVDVCDYAVGLSRSFSGQIFPSERPNHYM
LEQWNPIGTTGIITAFNFPVAVMGWNAALALVCGNPLIWKGAPSTNLCTLATQRIIQRVL
ERNGMPGSICVALTGGAEIGEAISKDPRVPLVSFTGSTQVGKIVATQVASRMGRSLLELG
GNNAITVLDDADLTLAVRSILFAAVGTAGQRCTTARRLFLHEKIHDDWARRWATRSRRTL
SSGPLHRPSSVDLYKNAVAKAQEQGGKIITGGKVKTDRPGNFVEPTIVSIKHDAPIALHE
TFAPILYVSKVPDLDTAIRYNNEVAQGLSSSLFTTNQQNVFKWIGPSGSDCGIVNVNIPT
NGAEIGGAFGGNKETGGGRESGSDSWKQYMRRSTWYGHLLPSPKSSYVEFITTHHNHNST
INYGKELPLAQGIKFD
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgaagaggttgagctgtgcatcgaagcaatttgtggtgccctcgcgggcctcccttcac
ctgcagggccgccgcggccttgccactggtggcagccaatacgccaagcacgcccgcttc
ctgcaatcgctgggcatcgaggagggggtcaacgatggcgtgtgcatcgatggcaagtgg
agcaagggcagcggcgaggtcgtcgactccgtcaacccggcctacaacgagaccatcact
cgcgtcgccaccgcggggctgaaggactacgagcgcgccatcgaggctaccaagagcgtt
gagaagatgtgggccgaggtgcctgcccccaagcgaggagagatcgtccgacagatcggt
gacgagctgaggaagcacctcgaggacttgggcgcgctggtctcgctcgaggtgggcaag
atcacccaggagggcatcggcgaggtgcaggagttcgtcgacgtctgcgactacgccgtc
ggtctctcccgctccttctccggtcagatcttcccgtcggagcgcccgaaccactacatg
cttgagcagtggaaccccatcggcaccacgggcatcatcaccgccttcaacttccctgtt
gccgtcatgggctggaatgcggcgcttgctctcgtttgcggtaacccgctgatctggaag
ggcgcaccctcgaccaacctgtgcacgctggccacccagcgcatcatccagcgcgtactg
gagcgcaacggcatgcccggctccatctgcgtggccctgaccggcggcgccgagatcggt
gaggccatctccaaggacccgcgcgtgccgctcgtctccttcactggcagcacccaggtg
ggcaagatcgtggcgacccaggtcgcgtctcgcatgggccgcagcctgctcgagctgggc
ggcaacaacgccatcaccgtgcttgatgatgccgacctcactctggctgtccgcagcatc
ctgttcgccgccgtgggtaccgctggccagcgctgcacgaccgctcgccgattgttcctg
cacgagaagatccacgacgattgggccagaagatgggcgacccgctcgagaagaacactc
tcctcgggtcccctccaccgcccctcctccgtcgacctctacaagaacgccgtcgccaag
gcgcaggagcagggcggcaagatcatcaccggcggtaaggtgaagaccgacaggcccggc
aacttcgtggagcccaccatcgtgtcgatcaagcacgacgcccccatcgccctccacgag
accttcgcgcccatcctctatgtctctaaagttcccgaccttgacacggccattcgttac
aacaacgaggtggcgcaggggctcagcagctcgctgttcaccaccaaccagcagaacgtc
ttcaagtggatcggacccagcggatcggattgcggtatcgtgaacgtgaacatcccgacc
aacggcgccgagatcggaggcgccttcggtggcaacaaggagaccggcggcggtcgcgag
tccggctccgactcctggaagcagtacatgcgcaggtccacctggtacggtcaccttctg
ccctcccctaagagctcttatgtggagttcatcaccactcaccacaaccacaacagcacg
atcaactacggcaaggagcttcctctggcgcagggcatcaagtttgactag

DBGET integrated database retrieval system