KEGG   Acanthamoeba castellanii: ACA1_165500Help
Entry
ACA1_165500       CDS       T02667                                 

Definition
histone acetyltransferase type b catalytic subunit
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
acan  Acanthamoeba castellanii
Brite
Enzymes [BR:acan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     ACA1_165500
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 425 aa AA seqDB search
MDVPLSSAADSAQNPTDVDQPAALGEWDCKANDVITFKLDSGGQAGEWGVFGPTLTHQVF
ENQLIRGYKRPRVSVLYTADSLLAFLRFDYDEKRFRTPLARGEEQQVITDVPGLLAKWLP
PSGVASSFDDFAREVGRPFEPPGDKIHSYTVESSGGSGTSATDDGTTVEYEIRKGSFAME
DLRQYHERIQLFLIWFIDRSSYIDDTDLDWELYFIFEKRRTFGETRYSIVGYATVYPFFS
FPDQRRLRISQFLILPPFQKQGHGEQLLRAIYREAWGRTGLYESVRDITVEDPSPEFKLL
RDITDLRLCLESGFLKGVPGDKIDPEQLRAVQSRFKLAKSQIEHLHEVLRYVHLDRCDEQ
VVTRFRLSVKRRLHKKYQDWLAGFEAGEARKKELDDIYREEIEGVYSSLARRLRTHLPPL
PHSPK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggacgtccccctttcttctgccgcagattcggcccaaaacccaacagacgtggaccag
cctgccgctcttggtgagtgggactgcaaggcgaacgacgtcatcacgttcaagctcgac
agtggcgggcaggcgggcgagtggggcgtgtttgggccgaccctgacgcatcaggtgttc
gagaaccagctcatccgcggctacaagcgcccgcgggtgtcggtgctctacaccgccgac
tccctgctggccttcctgcgcttcgactacgacgagaagcgtttccgcacgcccctggct
cgcggggaggagcagcaggtcatcaccgacgtgccgggtctcctcgccaagtggctccct
ccctccggcgtcgcctcctccttcgatgactttgctcgcgaggtgggcaggccgttcgag
cccccgggcgacaagatccactcctacacggtggagagtagcggtgggagtggtacgagc
gcgacagacgacgggaccaccgtcgagtacgagatccggaagggctccttcgccatggag
gacctccgccagtaccacgaacggatccagctcttcctgatatggttcattgatcgctcc
tcctacatcgacgataccgacctcgattgggaactctacttcatttttgagaaacggcgc
acgttcggagagacacgatacagcatcgtgggctacgccacggtgtaccccttcttctcg
ttcccagaccagcggaggctccgaatcagtcaattcctcatcctgccgccattccagaaa
caaggccacggagagcaactcttgcgggcgatctacagagaagcatgggggcgaacgggt
ctgtacgaaagcgtccgagacatcaccgtggaagacccctctcccgagttcaagctccta
cgggacatcactgatcttcgtctgtgtctcgagagtggcttcctcaagggcgtgccgggc
gacaagatcgaccccgagcagctgcgagcggtgcagagccgattcaagctggccaagagt
cagatcgaacacctgcacgaggtcctgcgctacgtgcacctggaccggtgcgacgagcag
gtcgtcacgcggttccggctgtctgtcaagcgacgactgcacaagaagtaccaggactgg
ctggccgggttcgaggccggggaagcacgcaagaaggagctggacgacatctaccgcgag
gagatcgagggcgtctactcttctctcgcccgccggctccgcacccacctgccccctctc
ccccactcacccaagtga

DBGET integrated database retrieval system