KEGG   Acanthamoeba castellanii: ACA1_219720Help
Entry
ACA1_219720       CDS       T02667                                 

Definition
bromodomain domain containing protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
acan  Acanthamoeba castellanii
Brite
Enzymes [BR:acan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     ACA1_219720
Transcription machinery [BR:acan03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     ACA1_219720
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 732 aa AA seqDB search
AVPHGGCGEDAPRRPLLLLFGSRLRKRPGWKGSKALTDEAASSLLGGTSATQRKMAGKMD
RYQCSACHHPLIGHGELMQLEEGELERRANVAQRIHKLIECRAPKPRITALREELFLSPA
DEADASAAGEADASPAMGQPPFEQPVIAQILHNFVSRMYKEGSEEKQKATQLRRLLVRVI
DGHEPAAPEDDDDYYDEGSGYRLNYRRWQQFCLSGEEDANHKPSKVNGLLTKKVKPLYPS
FMKALEKRKRKITGNTRSPPRTKKARTERDDEIDILTVVDDGKANKGPVTDGPVRPDGYD
DIENDEAGQDNNSTNNNHGLDDGYDEEEDEGLEPGRSMSMDEVRMLVPTPASDHVLLGPE
TGMDDMGSRDEMAKTEEKMGTIGFQIVRNDGTRRSLLWLADLRNVFSTQLPKMPREYIAR
LVFDTYHKSLVLVKQGQVIGGITFRPFPEQNFLEIAFCAISSGEQVKGYGTHLMNHLKDW
ARQQGTLHMLTYADNYAIGYFKKQGFTLSVTLAKKYWQGYIKDYEGASPMECVVHPGVSY
VDIPNIVRRQKECVMACMKERYGGFGRVYAGLQCFKKGRRIPISHIPGIERTSHGALRPP
TASVREERESMESLQVVFRDVLRSIKEHPSAWPFLQPVDKNEVWDYYDIIRDPIDLETME
KRLDTGQFYITREIFIADLRRMCQNCRRYNGPNNVYYDCAETIDRFVEEVFSAPLGHWER
PRTRKSAKPLLP
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
gcagtaccccatggcggttgtggagaagatgctccacgtcgcccccttcttctcctgttc
ggctcccgtcttcgaaaacggccaggatggaagggcagcaaagctcttaccgacgaggcc
gccagttccctgctcggaggaacctcggccacccagcgcaagatggccggcaagatggat
cgataccagtgctcggcctgtcaccacccgctcatcggacacggcgagttgatgcaattg
gaagagggcgaactcgaacgacgagccaacgtggcgcagcgcatccacaaattgatagag
tgccgcgccccaaagcctcgcattaccgccctgcgagaggaactgttcctgtcacccgcc
gatgaagccgacgcttcagccgcgggcgaagccgacgccagcccagcgatgggccagcct
ccctttgagcagcctgtcatagcacagattctgcacaattttgtttcacgaatgtacaag
gaggggtcggaggagaagcaaaaggccacacagctccggcgactattggtgcgagtcatc
gacggccacgagccggccgcgcccgaggacgacgacgattattacgacgagggctcaggc
tatcgattgaactatcgtagatggcaacaattctgtttaagtggtgaagaagatgccaat
cacaagccgtctaaggttaatgggctgttgaccaaaaaggtcaaaccgctctacccctcc
tttatgaaagccctcgaaaagcgcaagcgaaagatcacaggcaacacccgatcgccccca
aggaccaagaaggcccgcacggaacgggacgacgaaatcgacatcctcaccgtggttgac
gacggcaaagcgaataagggacccgtcaccgatggaccggtcaggccagatggctacgac
gacattgaaaacgacgaagccggccaagacaacaacagtaccaacaacaaccatgggctg
gacgatgggtacgacgaagaggaggacgaggggctggagcccggccgcagcatgtccatg
gacgaggtgcgcatgctggtgcccaccccggcgagcgaccacgtactgctgggacccgag
accggcatggacgacatggggtcgagagatgagatggcaaagaccgaggagaagatgggg
acgatcggcttccagatcgtgcggaacgacggcacgcggcggagcctgctgtggctggcc
gacctgcgcaacgtcttctccacccagctcccgaagatgccgcgcgaatacatcgcacga
ctcgtctttgacacgtaccacaagtcgctggtgttggtgaagcagggccaggtgatcgga
gggatcaccttccggccgttcccggagcagaacttcctcgagatcgccttctgcgccatc
tcatcgggcgagcaagtcaagggatacggcacccatttgatgaaccacctgaaggactgg
gcgaggcagcaagggacgctgcacatgctcacctacgccgataactacgccatcggctac
ttcaagaagcaggggttcacgctatcagtgacgctggcgaagaagtactggcagggctac
atcaaagactacgagggcgcgtctccgatggagtgcgtggtgcacccgggcgtgtcctac
gtcgacatccccaacatcgtccgccgccagaaggagtgcgtgatggcgtgcatgaaggag
cggtacggcggcttcggtcgggtgtatgcgggcctgcagtgcttcaagaagggccgccgc
ataccgatctcgcacatccccggcatcgagcggacgtcgcacggcgccctgcggccgccc
acggccagcgtgcgcgaggagcgcgagtcgatggagtcgctgcaggtggtcttccgcgac
gtgctgcgttcgatcaaggagcacccctcggcctggcccttcctccagccggtcgacaag
aacgaagtctgggactactacgacatcatacgcgaccccatcgatttggagacgatggag
aagcgactcgacacgggccagttctacatcacgcgagagatcttcatcgccgatctgcgt
cgcatgtgccagaactgccgacgatacaacggacccaacaacgtctactacgactgcgcg
gagacgatcgaccggttcgtggaggaggtcttctcggctccgctcgggcactgggagagg
cccaggacacgcaagagcgccaagcccctcctcccctga

DBGET integrated database retrieval system