KEGG   Acanthamoeba castellanii: ACA1_248630Help
Entry
ACA1_248630       CDS       T02667                                 

Definition
thioredoxin domain containing protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
acan  Acanthamoeba castellanii
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:acan00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    ACA1_248630
Enzymes [BR:acan01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     ACA1_248630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 406 aa AA seqDB search
MKGSSVMLVLLGCLFVLGVAVHSADALYSPKDGVILATDATFNALVLQSNRPSIVEFFAP
WCGHCKNLAPEYKKAAAATKGMVNIVAIDCDDASNRPLCGRYDVKGFPTLKLFTPGQKAP
TDYQGPRTAKPIVDAVLAKLDAKNIKKLTAKSAEGFLADKELPKVLLFTSKPKSSHLYMA
LSMEFKGKLAFAEILDKETSLAEKYGVESFPTLLVVKNDEEQTVTKYEGELGYRQLDSFL
ATFAPKSAKASKGAKSEKAEAKAEPTPVPLEQKLYALESDADYTKYCVEQRRICAIGFVP
SKEQDEEEHDKAVKALEALAAEREAGDAFLVMWVDGAKATGFRRTLDLAFDLPTFAVASP
KKKGYAPFRGAFTPKAMGEFLDSIKHGVKRTHPLPDFPASLFDAQA
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgaagggctcatctgtgatgttggtgttgcttgggtgcctctttgtgctgggggttgct
gtgcattctgccgatgccctctactcgcccaaggacggcgtcatcctcgccactgatgcc
accttcaatgcgctcgttctccagagcaatcgtccttccatcgttgagttcttcgccccc
tggtgtggacactgcaagaacctggctcccgagtacaagaaggctgccgccgctaccaag
ggcatggtcaatatcgtggccattgactgcgacgacgcctccaacaggcctctctgcggt
cgctacgacgtcaagggattccctacgctcaagctgttcacgccgggccagaaggccccc
acggactaccaaggtccgcgaacggccaagcccatcgtcgacgccgtgttggccaagctc
gacgccaagaacatcaagaagctgacggccaagagcgccgagggcttcctggccgacaag
gagctccccaaggtcctcctcttcacctccaagcccaagtcgagccacctctacatggcc
ctctccatggagttcaagggcaagctcgcctttgccgagatcctcgacaaggagacctcg
ctcgccgagaagtacggcgtggagtcgttcccgacccttctcgtggtgaagaacgacgag
gagcagaccgtgaccaagtacgaaggcgaactcggctaccggcagctcgattccttcctc
gcgaccttcgcgcccaagtccgccaaggccagcaagggcgccaagtccgagaaggccgag
gccaaggccgagcccactccggtcccgctggagcagaagctgtacgcgctcgagagcgac
gctgactacaccaagtactgcgtggagcagcgccgcatctgcgccatcggctttgtgccg
tccaaggagcaggacgaggaggagcacgacaaggcggtcaaggccctcgaggccctggcc
gccgagcgcgaggccggcgacgccttcctcgtgatgtgggtcgatggcgccaaggccacc
ggcttccgccgcacgctcgacctcgccttcgacctgcccaccttcgccgtcgccagcccc
aagaagaagggctacgccccgttccgcggcgccttcacccccaaggccatgggcgagttc
ctcgacagcatcaagcacggcgtcaagcggacccaccccctccccgacttccccgcctcc
ctcttcgacgcccaggcctaa

DBGET integrated database retrieval system