KEGG   Acanthamoeba castellanii: ACA1_291770Help
Entry
ACA1_291770       CDS       T02667                                 

Definition
MHCK/EF2 kinase domain containing protein
Orthology
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
acan  Acanthamoeba castellanii
Brite
Enzymes [BR:acan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     ACA1_291770
Protein kinases [BR:acan01001]
 Serine/threonine protein kinases: Atypical group
  Alpha family [OT]
   ACA1_291770
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 438 aa AA seqDB search
MLRCCAALCRITVPTAPGNSRPHVGNGFLAAVEHQERAYAEFSNSTDQSDVATIFLRPAA
MVPIRLAECLETPLAAEDAVHAIQYHQGGKHLSIQLVASIKGPVVSYVGDTLPGSSGSPV
FKHWRLVAIHDREGGSSNKGILMRTILAKFNLCGASSAPSSSSSSSSSSSSSSSPKPPPP
RPNFQRPHMAPPAPPAPPSSTFKIPDRERGETINCYTLVDGEARRWSKQTLRGIVEAQCM
ATGSLRSAYKAFAKGSFYVVKFFRPDALAALGIATTDALVKTLQEEVVMQWKAAGLAHRW
NAFGAMPKAVAFNPIVVVELAARQPPAWGVMEPLLDGAYVKYNDNEGRVFAQPEDGRVRD
TPQAFSHFSYLASGGTSLVCDLQGVGDVFTDPQVHTDPRSLCPVPGNRGLEGIRDFFASH
QCSLLCRLVQQKLQSASG
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgctgctgcgcggccctctgccgcatcacagtgcccaccgcacccggtaacagc
cgcccgcacgttggcaacggcttcctcgctgctgtggagcaccaggaacgggcctatgcc
gagttcagcaactcaacagaccagtccgacgtggcgacaatcttcctgcgtcctgctgcc
atggtgcccatcaggctcgccgagtgcctggagacgccgctggccgcagaggacgccgtc
cacgccatccagtaccaccagggcggcaagcacctgagcatccagctggtggccagcatc
aagggtcccgtggtgtcctacgtgggcgacaccctgcccggctcgtcgggctctccggtc
ttcaagcactggcgcctcgtcgccatccatgaccgagagggaggcagcagcaacaagggc
atcttgatgaggaccattctcgccaaattcaacctgtgtggagcttcatctgcaccttct
tcttcatcatcatcatcttcgtcatcatcgtcgtcttcgtcacccaagccacctccgcca
cggcccaatttccagcgtccgcacatggccccgccagccccgccagccccgccttcgtcg
acgttcaagatccccgaccgggagcggggcgaaacgatcaactgctacacgctcgtggac
ggcgaggcccggcggtggagcaagcagaccctgcgcggcatcgtcgaggctcagtgcatg
gccaccggctcgctgcggtcggcctacaaggccttcgccaagggcagcttctacgtggtc
aagttcttccggccggacgcgctggcggcgctgggcatcgccaccaccgacgccctggtc
aagaccctgcaggaggaggtggtcatgcagtggaaggccgccgggctggcccaccgctgg
aacgcgttcggcgccatgcccaaggccgtggccttcaacccgatcgtcgtggtcgagctc
gccgcccggcagcccccagcgtggggcgtcatggagccgctacttgacggggcctacgtc
aagtacaacgacaacgagggccgcgtgttcgcccagccggaggacgggcgtgtgcgggac
acgccgcaggccttcagccacttcagctacctggcgagcggcgggacctcgctggtgtgc
gacctgcagggcgtgggcgacgtgttcaccgacccgcaggtgcacacggacccgcgctcg
ctgtgcccagtgccgggcaatcgcggtctggagggcatacgcgacttctttgccagccac
cagtgctccctcctctgtcgcctggtccagcagaagctgcagtcggccagcggttga

DBGET integrated database retrieval system