KEGG   Acanthamoeba castellanii: ACA1_296720Help
Entry
ACA1_296720       CDS       T02667                                 

Definition
histone deacetylase 1, putative
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
acan  Acanthamoeba castellanii
Brite
Enzymes [BR:acan01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     ACA1_296720
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 328 aa AA seqDB search
MSKQRICYFYDGDVGNYYYGNGHPMKPHRIRMTHNLLLNYGLYKQMKIYRPRHATKQEMA
QFHAEDYVKFLRLITPDNMNEYTKQLQRFNVGEDCPVFDGMYQFCQISSGGSIGGAVKLN
HGESDIAINWAGGLHHAKKSEASGFCYINDIVLAILELLKYHARVLYIDIDIHHGDGVEE
AFYTTDRVMTVSFHKYGEYFPGTGDIRDIGAQKGKYYSVNFPLRDGIDDESYENIFKPII
QKVMDWYRPGAVVLQCGADSLSGDRLGCFNLSLKGHGACVEFVQSFGLPLLVLGGGGYTI
RNVARCWTYETALLLKKDINDALRWRLG
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcagaggatctgctacttctacgatggggatgtgggcaactactactacgga
aacggacacccgatgaagccgcaccgcataaggatgacccacaacctgctcctcaactat
ggcctctacaagcagatgaagatctacaggcccaggcacgccacaaagcaggagatggcg
caattccacgccgaagactacgtcaaattcctaagattgatcactcccgacaacatgaat
gagtacaccaagcaactgcaaagattcaacgtgggcgaagattgtcctgtctttgatgga
atgtatcaattctgccagatctcttctggtggttcaatcggtggcgctgtgaagctcaac
cacggcgagtccgatatcgccatcaactgggctggcggccttcaccacgccaagaagtcg
gaggcctctggcttctgctacatcaacgacatcgtgctggccatcctcgaactgctcaag
taccacgcgagagtcctgtacattgacattgacattcatcacggcgacggtgtcgaagag
gccttctacaccaccgaccgcgtgatgaccgtctccttccacaagtacggagagtacttc
cctggcacaggcgacatcagggatattggagcacagaagggcaagtactattcggtcaac
ttcccgctgagggatggcatcgacgacgagagctacgagaacatcttcaagcccatcatc
cagaaggtgatggactggtaccggccgggagcggtcgtgctccagtgcggcgcggactca
ctatcgggcgatcgtctgggctgcttcaacctctcgctcaagggccacggcgcgtgcgtc
gaatttgtacagagctttgggctgcccctcctagtccttggtggcggcggttacaccatc
cgtaacgtcgctcgttgctggacctacgagactgccctcctcttgaagaaggacatcaat
gacgctctgcgttggcgccttggctga

DBGET integrated database retrieval system