KEGG   Acanthamoeba castellanii: ACA1_323150Help
Entry
ACA1_323150       CDS       T02667                                 

Definition
cytochrome b5 domain containing protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
acan  Acanthamoeba castellanii
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:acan00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    ACA1_323150
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    ACA1_323150
Enzymes [BR:acan01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     ACA1_323150
Lipid biosynthesis proteins [BR:acan01004]
 Desaturase
  First
   ACA1_323150
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 724 aa AA seqDB search
MEELKLMCPTMPSISDITPKVQQMLKFPKKLFERSSGKAFLRLTKAIVLLTTAYAFLTVM
PWYLLPLGWIITGTCFASLLAVGYACGTDTFFNNTVINHIVGQICLIPLMLPFEAWREEL
TQQKETVCAKVQNYLSSFWQGITAHIEALFSLKSKRVLGNLVVLYLVAGIFFPLVIYFTG
VWGLFKYYIMPIVVYHFWASSFLKTSSLLKLLSNIEKSDLVTLAHYKYPKWVEFLSCELN
YAVSSLHQFTTSLNVDLPAEEEETTESKDNLKKERRVKQANPMIPIYNLKEAFKFLKEST
AESISVRLEEVDFFALLKSRTGELVSKGLIKDATQARDVIADMLKEVNWITAIFLAVTPV
LGAVGLIYCQYYWQTWVLFFFHYLTGGIGITAGYHRLFSHRAYSAHPIFKYTLLFFATGC
FQMSCLEWCNDHRAHHRYTDTDKDPYTIKKGFWYAHLGWLLWQREPPKSDIRDLQRDPVM
RFQDEYYAPLALFQGLILPTAIAGMFWGDWMGGFLIAGVLSRVLVHHATFCVNSVAHYFG
SFTYSDQRTPRDSWLVGLITFGEGYHNFHHEFPYDYRNGAEYHSFDPTKWLIWALSYVGG
TYHLMRFDKETIEKGKLQMLEKEVIRRRELLHWGPQPDTLPEYTMEKVQEEFSKGEQLIV
VDGFVHDVRGFIDEHPAGSAIVKPYLGKDASAAFNGLVYNHSNAARNIIDTLRIGRLVEK
EKSE
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atggaggaattgaagctcatgtgcccgaccatgccgtcgatctctgatatcacccccaag
gtgcagcagatgctgaagttccccaagaagctgttcgagcgcagcagtggcaaggccttc
ctcaggctcaccaaggccatcgtcctgctcaccaccgcctatgcgttccttaccgtcatg
ccgtggtatctcctgccactcggctggatcatcacaggcacctgcttcgccagtttgctg
gcggtgggttatgcctgcggtaccgacacgttcttcaacaacaccgtcatcaaccacatt
gttggccagatctgcctgattcccctcatgctccccttcgaggcctggcgcgaggagctc
acgcagcagaaggagaccgtgtgcgccaaggtgcagaactacctgtcctcgttctggcag
ggcatcaccgcgcacatcgaggccctcttctccctcaagagcaagcgtgtgctgggcaac
ctggtggtcctctacctggtggccggtatcttcttcccgctggtcatctatttcaccggc
gtgtggggcctgttcaagtactacatcatgcccatcgtggtgtaccacttctgggcctcc
tcgttcctgaagacctcgtccctcctcaagctcctctccaacatcgagaagagcgacctc
gtgactcttgcccactacaagtaccccaagtgggtcgagttcctctcgtgcgagctcaac
tatgccgtgtcctcgctgcaccagttcaccacctcgctcaacgtcgatctcccggccgaa
gaggaggagacgaccgagagcaaggacaacctgaagaaggagaggagggtcaagcaggcc
aaccccatgatccccatctacaacctcaaggaggcgttcaagttcctcaaggagtcgacc
gcggagtccatctccgtccgcctggaggaggtcgacttcttcgcgctgctcaagtcgcgc
accggtgagctcgtcagcaagggcctgatcaaggacgccacccaggcccgcgacgtcatc
gccgacatgctcaaggaggtcaactggatcaccgccatcttcctggccgtcaccccggtc
ctcggtgccgtgggcctcatctactgccagtactactggcagacgtgggtgctgttcttc
ttccactacctcaccggaggcatcggcatcaccgccggctaccatcgcctgttctctcac
cgcgcctactcggcccaccccatcttcaagtacaccctcctgttcttcgccaccggctgc
ttccagatgtcgtgcctggagtggtgcaacgaccacagggcccaccacaggtacaccgac
acggacaaggatccctacacgatcaagaagggcttctggtacgcccacctgggctggctg
ctctggcagagggagcctccgaagtcggacatccgcgacctgcagcgcgaccccgtcatg
cgcttccaggacgagtactacgcgcccctggccctgttccagggtctgatcctgcccacc
gcgattgccggcatgttctggggtgactggatgggcggcttcctcatcgccggcgtgctg
tcgcgcgtgttggtgcaccacgccacgttctgcgtgaacagcgttgcccactactttggt
tcgttcacctactctgaccagcgcaccccgagggactcgtggctggtgggtctcatcacc
ttcggcgagggctaccacaacttccaccacgagttcccctacgactaccgcaacggcgcc
gagtaccactcgttcgaccccaccaagtggctcatctgggctctctcgtacgtgggcggc
acctaccacctcatgcgcttcgacaaggagaccatcgagaagggcaagctccagatgctc
gagaaggaggtcatccgccgccgcgagctactgcactggggtccgcagcccgacaccctc
cccgagtacaccatggagaaggtccaggaggagttctccaagggcgagcagctcatcgtc
gtggacggcttcgtgcacgacgtgcggggcttcatcgacgagcaccccgccggctccgcc
atcgtcaagccttacctgggcaaggacgcgtcggctgcgttcaacggcctggtgtacaac
cactcgaacgctgcgcgcaacatcatcgacaccctgcgcatcggcaggctggtggagaag
gagaagagcgagtaa

DBGET integrated database retrieval system