KEGG   Acanthamoeba castellanii: ACA1_326120Help
Entry
ACA1_326120       CDS       T02667                                 

Definition
glycogen synthase Gsy1, putative
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
acan  Acanthamoeba castellanii
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:acan00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ACA1_326120
Enzymes [BR:acan01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     ACA1_326120
Glycosyltransferases [BR:acan01003]
 Polysaccharide
  Storage polysaccharide
   ACA1_326120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 660 aa AA seqDB search
MQQPPARRYSMDRFASELDFTDTRPVLFDVGWEVAKKVGGIYTVLKSKSPITVEEFGGRY
ALVGPYNQATAATEMEEMEPGPLFGPVIARLRERYGIIVHFGKWLVDGYPKVLLIDVNSS
MHELDKWRGELMGGWDVPGDFECNDGIVFGYQTALLIREFTQIYRDIRLIAHFHEWQAAV
GLIVARIWNVKFASIFTTHATLLGRFLASGGVDLYNQIAQINVDSEASRRGIYHRHWIEQ
RAAQECHVFTTVSEITAYEAERILRRRADVIVPNGLQVKKFTALHEFQNLHAKYKEVIHE
FVLGHFYGHYNFDLDNTVYFFTSGRHEYFNKGVDMFIDALAGLNYLLKQRGSNITVVAFI
IMPAPTNNFNVESLKGQSLIRDLKRTTTHVVEKLSDRIFEATARGQMPDVNDLLKEEEIV
MLKRRIYTVKQRNIYPPIVTHNMINEGKDEILNHLRRVKLWNDPADRVKVIYHPEFLSST
SPLIPLDYPDFVRACHLGIFPSYYEPWGYTPAECTVLGVPSITTNLSGFGNYVHTNIEDH
DSKGLFIVDRRFKAPNETVDQIIDILWKFCQLDRRHRIELRNRCEQMSQMLDWKNLGKAY
QEARHLALERVYGPVDQPDIGALKMCAPPPSSQMCGVCGVCGVCLTEMQRCVVVDMCSSS
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagccaccagcacgtcgctattccatggaccggttcgcgagcgagctcgacttc
accgacacgaggccggtgctgttcgacgtcgggtgggaggtggccaagaaggtgggcggc
atctacaccgtgctcaagtccaagtcgcccatcacggtcgaggagttcggcggccgctac
gcgctggtcggcccctacaaccaggccaccgccgccaccgagatggaggagatggagccc
ggcccgctcttcggccccgtcatcgcccgcctccgcgagcgctacggcatcatcgttcac
tttggcaagtggctcgtcgacggttatcccaaggtgctcctgatcgacgtgaacagctcg
atgcatgagctggacaagtggaggggcgagctcatgggcggctgggacgtgcccggcgac
ttcgagtgcaacgacggcatcgtgttcggctaccagacggcgctgttgatcagggagttc
acccagatctaccgcgacatccgtctcatcgcccacttccacgagtggcaggccgccgtg
ggcctcatcgtcgcccgcatttggaacgtcaagttcgccagcatcttcaccacccacgcc
accctcctcggcaggttcttggcctctggcggcgtggacctgtacaatcagatcgcgcag
atcaacgtcgactccgaagcctcccgccgcggcatctaccaccgccactggatcgaacag
cgcgccgcccaggaatgccacgtattcacgacggtgtcggagatcacggcctacgaggcc
gagcggatcctgcggcggcgcgcggacgtgatcgtgcccaacggtctccaggtgaagaag
tttacggcgctccacgagttccagaacctgcacgccaagtacaaggaggtgatccacgag
ttcgtgctgggccacttctacggccactacaacttcgacctcgacaacacggtctacttc
ttcacctcgggccgccacgagtacttcaacaagggcgtcgacatgttcatcgacgcgctg
gccggcctcaactacctcctcaagcagcgagggtccaacatcaccgtcgtcgccttcatc
atcatgcccgccccgaccaacaacttcaacgtcgagtccctcaaaggccagtcgttgatc
agggatctgaagcgtacgacgacgcacgtggtggagaagctgtccgaccgcattttcgag
gccacggcccgcggccagatgcccgacgtcaacgatctcctcaaggaggaggaaatcgtg
atgttgaagaggcgcatctacacggtgaagcagcgtaacatctacccgcccatcgtcacc
cacaacatgatcaacgagggcaaggacgaaatcctgaaccacctgaggcgcgtcaagctg
tggaacgaccccgccgaccgagtcaaggtgatctaccacccggagttcctgtcgtcgact
tcgccgctcattccgctggactaccccgacttcgtgcgcgcctgccacctcggcatcttc
ccctcctactacgagccgtggggttacacgcccgctgagtgcacggtgctcggtgtgccc
tcgatcaccaccaacttgtccggtttcggtaactacgtgcataccaacatcgaggaccac
gactccaagggtctgttcatcgtcgacaggcgcttcaaggcgcccaatgagacggtcgac
cagatcatcgacattctctggaagttctgccagctcgaccgcaggcacaggattgagctg
cgcaaccgctgcgagcagatgtcgcagatgctggactggaagaacctgggcaaggcctac
caggaggcccgccacctcgccctcgagagggtctacggccccgtcgaccagcccgacatc
ggcgccctcaaaatgtgcgccccccccccttcgtcacaaatgtgcggtgtgtgcggtgtg
tgcggtgtgtgtctgactgaaatgcaacgttgcgtggtggttgatatgtgtagcagctcg
taa

DBGET integrated database retrieval system