KEGG   Acanthamoeba castellanii: ACA1_368260Help
Entry
ACA1_368260       CDS       T02667                                 

Definition
Phosphatidylinositolspecific phospholipase C, X domain containing protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
acan  Acanthamoeba castellanii
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:acan00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    ACA1_368260
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    ACA1_368260
Enzymes [BR:acan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     ACA1_368260
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 1006 aa AA seqDB search
MAGVDTDEATDSEDDGDDAIGVYLRIGIKTLNFSNFPTPGDESSDELSESEEDERAHWAT
QSSGEIPVVVPSRTKDKQRVSDSDSEEDLTSSDLSDTEEDSQEEEEQLRQNEAKRLATKL
QEGANFLLVTRKHGVRPSHVRLSGDQRTIICRRHTILLDSVDELREGQATAEFEIHRQPD
KTHLSFSLIYNMRKAFNLIAENEEQYKTWVNTLKCLIKKQVDEESAYAERAWHALGGKSE
LSVEEILRLMRKLNMRPTKAYAEEMLRIVDANSDGHLQYEEFLQLLRLLRQRAELHELFD
KYATDDDVLTPKQFLKFLQREQKEDMSLKQCTIIMKKFMGECKDIDITLNTLLPSAAAFG
SAKRRQRFLRLLRQIFLHFPSFVKHTAKLAKEKADRHRIKKREPAYLDEAHAQETGSGGS
SSSAPDGAAAEPAESAEPSPADDDHRGRSTRPDPPVGTAMKRQGSIVDFWNDWAEAKERK
DRREQQEKAETDKKDKDEIVKVTMNRWQFFQYMISDHNSVFIPEKRKLYQDMKRPITDYF
IASSHNTYLTGNQLKSKSATEMYVLALKQGCRCLELDCWDGKRGYPIVYHGHTLTSRVRF
EDAVIAIAKYAFFSSPYPLILSLEVHCSKPQQIMMAEMMRLTFRDRKAFGDMLALPFVDG
ERDSLPSPEDLKYKILLKGSPVRLQADETEQEEGQDRKSVRKAPKEKVAQELSDVLYLKS
VHFDSFQQFKEEKCNRMTSLAEVRGFKLLTSAAPELVNLNRHKFTRIYPKGTRFASTNYD
PVPFWNAGSQLVALNYQHVGKKMFYNHGKFLENGQCGYVLKPPVLRSDNRRRFDPRQSTH
LSTSTVRRLTVQIINARQLPHVAKVVNPYAIVAVNGVEKDARAFRTKVVRNNGFDPQWNQ
TFDFPLTASELGIFLIAIYDKRERFAKDRLICYYSIPVECIRAGYRVMHLFDKKGKRIPM
SNLLCRFSLKQSILGPNLDRMNANMNKLQSTLTLPRLPSLAWTHKK
NT seq 3021 nt NT seq  +upstreamnt  +downstreamnt
atggctggcgtggatactgacgaggccaccgacagcgaggacgacggcgacgatgccatc
ggcgtatacctgcgcatcggcatcaagaccctcaatttttccaatttccccacacctggc
gatgaaagctcagatgagctctcagaatcggaggaagacgagcgggcgcactgggccact
cagtcgtcgggcgagatcccagttgtggtgccttcgcgtaccaaggacaagcagcgggtg
agcgacagcgacagcgaggaggatttgacgtcgagcgatctgtccgacacagaggaggat
tcccaagaagaggaggaacagctgcggcaaaacgaagccaaacgactggcgacgaagctg
caggagggcgccaacttcttgctcgttacccgcaagcacggcgtgcggcccagccatgtg
cgtctcagcggcgatcaacgcaccatcatctgccggcgacacaccattttgctcgacagc
gtggatgagctgagggagggccaggcgacggctgaattcgagattcacagacaaccggac
aagacgcacctgtcgttctcgctgatctacaacatgcgcaaggcgttcaacctgatcgcg
gagaacgaagaacagtacaagacgtgggtgaataccctcaagtgtctcatcaagaagcag
gtggacgaggaatctgcatatgcggagcgggcgtggcacgccttgggcggtaagtctgag
ctgtcggtggaggagatattgaggctaatgcggaagctgaacatgcggccgaccaaggcg
tatgccgaagagatgctgcgcatcgttgacgccaacagcgatggccatctacagtatgag
gaattcttgcagctgctgcgattgttgcgacagagggcagagctgcacgaactgttcgac
aaatatgcgaccgacgacgacgtgctgacgcccaagcagttcctcaagttcctacagcgc
gagcagaaggaggacatgtcgctcaagcagtgcaccataatcatgaaaaagttcatgggc
gagtgtaaggacatcgatattaccctcaacaccctgttgccttcggccgcggcctttggc
tcggccaagagacgccaacggttcttgcgactgctgcgtcagatcttcctccacttccct
tccttcgtgaagcacacagccaagctggcgaaggagaaggcggaccgacaccgcatcaag
aagcgcgaaccggcctacctggacgaagcgcacgcccaagagaccggcagcggagggagc
agctcgagcgccccggacggcgctgctgcggagcctgcagagtccgcggagcccagcccg
gcagacgacgaccacaggggacgcagcacaaggccagaccccccggttgggactgcgatg
aagcgacagggcagcatcgtcgacttctggaacgactgggccgaggcaaaggagcggaag
gaccgacgcgagcagcaagagaaagccgagaccgacaagaaggacaaggatgaaattgtc
aaggtcaccatgaataggtggcagttcttccagtacatgatctccgatcacaactcggtc
ttcatccccgagaagcgaaagctctaccaggacatgaagcgaccgatcaccgactacttt
attgcgtcctcgcacaatacctacctgaccggcaaccaactcaaatccaagtcggccacg
gagatgtacgtgctggcgctcaaacagggatgccgctgtctagagctggactgctgggac
ggcaagcgcggttacccgatcgtttaccacgggcacacgctcacttcgcgagtgcgattc
gaggatgctgtgattgccatcgccaaatacgccttcttttcgtcgccgtacccgctcatc
ttgtcccttgaagtccactgctccaagccgcaacagatcatgatggccgagatgatgagg
ctcaccttccgcgacaggaaagcgtttggggacatgctggccttgccgttcgtcgatggc
gagcgggattctctgccctcgcccgaggacctcaagtataagattttgctcaagggttcc
ccggtcagactgcaggcggatgagacagagcaagaagaggggcaggacaggaagtcggtc
agaaaggcgcccaaggagaaggtcgcgcaggagctgagcgacgtgctctacctcaagtcg
gttcacttcgacagcttccagcaattcaaagaggagaagtgcaaccgtatgacctcgctc
gccgaagtccgcggcttcaagctgttgacttctgccgcgccggagctcgtcaacctcaac
cgccataagttcactcgtatctatcccaagggtacccgtttcgcctcgaccaactacgac
ccggtgccgttctggaacgcagggtctcaactcgtagcgctcaactaccagcatgtgggc
aagaagatgttctacaaccatgggaagttcctcgagaacggccagtgcggttatgtgctc
aagccgccagtgctcaggtctgataacaggcggcgattcgacccgaggcaatccacgcac
ctctcgacctcgactgttcgtcggttgacagtacagataatcaatgctcgccagctgcct
cacgtggccaaggttgtcaacccttacgcgattgttgcggtgaacggagttgagaaggac
gcgcgtgccttcaggacgaaggtggtgaggaacaacggcttcgacccgcagtggaaccaa
acgtttgacttccccctgacggccagcgaactcggcattttcctcatcgccatctacgac
aagcgagagcgcttcgccaaggatcgtctgatctgctactactccatccccgtggagtgc
atacgcgcgggctatcgagtgatgcatctgttcgataagaagggcaagcgcattccgatg
tcgaacctcctctgtcgcttcagcctcaagcagtcgatactgggacccaacctggaccgc
atgaacgccaacatgaacaagctgcagtcgactctgacccttccccggctgccttccctc
gcctggacccacaagaagtga

DBGET integrated database retrieval system