KEGG   Acanthamoeba castellanii: ACA1_369650Help
Entry
ACA1_369650       CDS       T02667                                 

Definition
3oxo-5-alpha-steroid 4-dehydrogenase 1, putative
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
acan  Acanthamoeba castellanii
Brite
Enzymes [BR:acan01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     ACA1_369650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 272 aa AA seqDB search
MAAEAASGPVMVPWLGIDEETFLQWAGYIMIGSGLVTFVASQATRAPYGRYSHEAGNMYG
PPVPARLAWMLQECPSVFVPLICLLFGSEASLAGLVNCVLVGLFLVHYIQRSFVFPFLIR
GGKPTPAVLVLMAFVFCLGNGYMQGRYHTRYAVYADDWVYDPRFIVGIVLFFAGMFINIQ
ADSILRNLRKPGETAYKIPRGGMFEYVSGANFFGEILEWTGFALASWSVVAFAFAFFTFS
NTGPRGVQHHQWYQKKFNDYPKTRKGVIPFVW
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagaggctgcgagtggaccggtgatggtgccgtggttgggcatagatgaagag
acgttcctgcagtgggcaggctacattatgatcggcagtggcttggtcacctttgtggcg
tcgcaggccacccgcgcgccgtacggccgctacagtcacgaggcgggcaacatgtacggc
ccgcccgtaccggcccgcctcgcctggatgcttcaggagtgcccctccgtcttcgttccc
ctcatctgcctcctcttcggaagcgaggcaagcctggcagggctcgtgaactgcgtgctg
gtgggtctgtttttggtgcactacatccagcgatcgttcgtgttccccttcctcatacgc
ggaggcaagcccaccccggccgtcctcgtcctcatggcctttgtcttctgcctcggcaac
ggctacatgcagggacgctaccacacgcgctacgcggtgtatgccgacgactgggtctac
gatccgcgattcatcgtgggcatcgtcctcttcttcgctggcatgttcatcaacatccaa
gccgactccattctccgcaatcttcgtaagcctggcgagacggcgtacaagatcccgagg
ggaggcatgttcgagtacgtgtcgggcgccaacttctttggcgagatcctcgagtggacg
ggcttcgcgctggcctcgtggtcggtggtggccttcgccttcgccttcttcaccttcagc
aacacgggtccgcgcggcgtgcagcatcaccagtggtaccagaagaagttcaacgactac
cccaagacacgcaagggtgtcatcccgttcgtgtggtga

DBGET integrated database retrieval system