KEGG   Acanthamoeba castellanii: ACA1_376730Help
Entry
ACA1_376730       CDS       T02667                                 

Definition
Glutamate/Leucine/Phenylalanine/Valine dehydrogenase family protein
Orthology
K00261  
glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
acan  Acanthamoeba castellanii
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acan00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    ACA1_376730
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ACA1_376730
   00330 Arginine and proline metabolism
    ACA1_376730
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    ACA1_376730
Enzymes [BR:acan01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     ACA1_376730
Exosome [BR:acan04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   ACA1_376730
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 469 aa AA seqDB search
MSFLESVLHNFNKAAALTGLSEPQIANIRKCAAVFRVKFPVRVNLNEKTGEYDTMIVEGF
RVQHSHHRLPCKGGIRYSEHVDQEEVMALASLMTYKCAIVDVPFGGAKGGIKINPRELGV
SQIEAITRRYASELIKRNMLGPGMDVPAPDMGTGPREMAWIKDTYEAFHPQDVNSLACVT
GKPISQGGIRGRTEATGLGVFFTVREAVNYEEDMKALGLTTGLKGKRVVIQGFGNVGSYS
AKFMHEAGAKIIAIGERDGGLYNKDGIDITALWNHIGEKKPFLSFPGAAVVKNPESLLEE
ECDILVPAALENQINATNALRIKAKIIAEAANGPVTATADEMLEKRGIIVIPDILCNAGG
VTVSYFEWVKNLSHVRMGRLERRYDQRSKERLLEHFSNITGRKEDVPAGVVSGANEADLV
HSGLEDTMIEGYANVRSVSKLKNCSMRTAAFVDAIRKVARSYAELGVFP
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcctcgagagcgtgctgcacaacttcaacaaggctgctgctcttaccggcctg
agcgagccccagattgccaacatcaggaagtgcgctgccgtcttccgcgtcaagttcccc
gttcgcgtcaacctcaatgagaagaccggcgagtacgacaccatgatcgttgagggcttc
cgcgttcagcacagccaccaccgtctgccctgcaagggtggtatccgttacagcgagcac
gtcgaccaggaggaagttatggccctggcctcgctcatgacctacaagtgcgcgatcgtt
gacgttcccttcggcggcgccaagggcggtatcaagatcaacccccgcgaactcggtgtt
tcgcagattgaggccattacccgtcgttatgcctccgagctgatcaagcgcaacatgctt
ggccccggcatggatgtgcccgcccccgacatgggcactggtccccgcgagatggcctgg
atcaaggatacctatgaggccttccatccccaggatgtcaactcccttgcctgcgtcacc
ggcaagcccatctcccagggtggtatccgtggcagaaccgaggccaccggtcttggtgtg
ttcttcaccgtcagggaggccgtcaactacgaggaggacatgaaggccctcggcctcacc
accggcctcaagggcaagcgcgtcgtcatccagggcttcggtaacgtcggttcgtactct
gccaagttcatgcacgaggccggcgccaagatcatcgccatcggcgagagggacggtggt
ctctacaacaaggacggtatcgacatcaccgccctctggaaccacatcggcgagaagaag
cccttcctctcgttccccggcgccgcggtcgtcaagaaccccgagtccctgctcgaggag
gagtgcgacatcctcgtgcccgccgccctcgagaaccagatcaacgccaccaacgccctc
cgcatcaaggccaagatcatcgccgaggctgccaacggccccgtcaccgccaccgccgac
gagatgctcgagaagaggggcatcatcgtcatccccgacattctctgcaatgctggtggt
gtgaccgtctcctacttcgagtgggtcaagaacctgtcgcacgtgcgcatgggtcgtctt
gagaggcgttacgaccagaggtccaaggagaggctcctcgagcacttctccaacatcacc
ggcaggaaggaggacgtccccgccggcgtcgtctccggtgccaacgaggccgacctcgtc
cactccggtctggaggacaccatgatcgagggctacgccaacgtgcgctccgtctccaag
ctgaagaactgctccatgaggactgctgccttcgttgatgccatccgcaaggtcgcccgc
tcgtacgccgagctcggtgtcttcccctaa

DBGET integrated database retrieval system