KEGG   Acanthamoeba castellanii: ACA1_378160Help
Entry
ACA1_378160       CDS       T02667                                 

Definition
Ubiquitin carboxylterminal hydrolase, family 1
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
acan  Acanthamoeba castellanii
Brite
Enzymes [BR:acan01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     ACA1_378160
Peptidases [BR:acan01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   ACA1_378160
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 241 aa AA seqDB search
MAEQQEQKAPVWLPLESNPDVLTKLAHGLGASPEWSFTDIWGLDDEVLDAQTPMFTAPVI
ALLFLFPSKEDAEARKLPADESAAIPVYFLRQVRSLGNACGTIGVIHSLANLAKSGFPIL
GSGALQNFIDKTKDKTPEERGDLLAFDEEIRKIHDGFAQQGQTEAPGEGDRVDFHFISFL
NVDNHVWSLDGMRAQPTDRGATSQETFLKDCAKIIKSEWLEKNKEEKLFSVIALTQLSED
D
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggcagagcagcaggaacagaaggccccggtttggttgcccctggagagcaatcctgac
gtgctcaccaagctggcgcacggtttgggtgcctcgcccgagtggtccttcacggacatc
tggggcctcgacgatgaggtgctggatgcacagacccccatgttcaccgcgccagtgatc
gcgctgctgttcctgttcccgtccaaggaggacgccgaggccaggaagctccccgctgac
gagagcgcagccatccccgtctacttcctgcggcaagtgcgctctctgggcaacgcctgt
ggcaccatcggcgtgattcactccctggccaacctcgccaagtccggtttccccatcctg
ggctcgggtgccctgcagaacttcattgacaagaccaaggacaagacgcccgaggagaga
ggcgaccttctggcctttgacgaggagatcaggaagatccacgacgggttcgcgcagcag
ggccagaccgaggcgcccggcgagggcgaccgcgtcgacttccacttcatcagcttcctc
aacgtcgacaaccacgtgtggagcctggacggcatgcgcgctcagcccaccgacaggggc
gccaccagccaggagaccttcctcaaggactgcgcgaagatcatcaagtcagagtggctg
gagaagaacaaggaggagaagctcttctccgtgatcgcacttacccagctgtccgaggac
gactag

DBGET integrated database retrieval system