KEGG   Acanthamoeba castellanii: ACA1_400280Help
Entry
ACA1_400280       CDS       T02667                                 

Definition
extracellular response kinase, putative
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
acan  Acanthamoeba castellanii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 416 aa AA seqDB search
MSGADESEEVDRHVLKRYEVGQKLGKGAYGIVWKSVDKKTKETVALKKIFDAFQNDTDAQ
RTFREIMFLQELEHENIIGLQNVMKAENDKDIYLVFEYMETDLHAVIRANILEDIHKQYI
IYQLLKSLKYMHSANVLHRDLKPSNILLNSDCLVKVADFGLARSIKALEENKEENQVLTD
YVATRWYRAPEILLGSTKYTKGVDMWSVGCIMGELLLGKPLFPGNSTMNQLDRVIEVTGR
PSTEDIEGVQSPFALTILESLPPSTPRSLSEIFPKATEEARDLLRKLLMFNPEKRITADD
ALKHPWLSQFHNEAEEAVHTGNIELIIDDNKKFPIAEYRSTLYNDIKKKRKERRRRAKLL
KKEKTDQAKVVKSEDKKEKRGSKILKKSEEKKEKRSSKILGKREGSKRESRKDKSA
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgagcggagccgacgaaagcgaggaagttgatcgccatgtgctgaagagatacgaagtt
ggccagaagctcggcaagggagcctatggcatcgtatggaagtcagtggacaagaagacg
aaggaaaccgtggctctgaagaagatcttcgacgccttccagaatgacaccgacgcccag
cgcaccttcagagaaatcatgttcctccaggagctggagcacgagaacatcatcggcttg
cagaacgtcatgaaggccgaaaacgacaaggacatctacctcgtcttcgaatatatggag
acggacctgcacgccgtcatccgagccaacatcctggaggacatccacaagcagtacatc
atctaccagctgctcaagtcgctcaagtacatgcactccgccaatgtgctgcacagggac
ctgaagccctccaacattctgctgaacagcgactgcctggtcaaggtggccgacttcggt
ctggcccggtccatcaaggcgctcgaggagaacaaggaggagaaccaggtgctgacggac
tacgtggccacgcgctggtacagagcgcccgagatcctgctcggctcgaccaagtacacc
aagggcgtcgacatgtggagcgtgggctgcatcatgggcgagctgctcctgggcaagccc
ctcttccccggcaactccaccatgaaccagctcgacagggtgatcgaggtgaccggccgc
ccctcgaccgaggacatcgagggagtgcagtcgcccttcgccctcaccatcctcgagtcc
ctgccgccctccaccccgcgttcgctctcggagatcttccccaaggccaccgaggaggcg
agggacctgctgcggaagctcctcatgttcaatcccgagaagcgcatcaccgccgatgat
gccctcaagcacccctggctgtcgcagttccacaacgaggccgaagaagccgtccacacg
ggcaacatcgaattgatcatcgatgacaacaagaagttccccattgccgagtacaggagc
acgctctacaacgacatcaagaagaagaggaaggagaggaggcgaagggccaagcttctc
aagaaggagaaaaccgatcaagccaaggtggtcaagtcggaagataagaaggagaagcga
ggcagcaagatcctcaagaagagcgaggagaagaaggagaagaggagcagcaagatcttg
ggcaagcgggagggcagcaagagggagagccgaaaggacaagagcgcctga

DBGET integrated database retrieval system