KEGG   Acinetobacter baumannii ATCC 17978: A1S_0062Help
Entry
A1S_0062          CDS       T00486                                 

Definition
(GenBank) putative UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
acb00040  Pentose and glucuronate interconversions
acb00052  Galactose metabolism
acb00500  Starch and sucrose metabolism
acb00520  Amino sugar and nucleotide sugar metabolism
acb01100  Metabolic pathways
acb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:acb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    A1S_0062
   00052 Galactose metabolism
    A1S_0062
   00500 Starch and sucrose metabolism
    A1S_0062
   00520 Amino sugar and nucleotide sugar metabolism
    A1S_0062
Enzymes [BR:acb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     A1S_0062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ABO10557
Position
73185..74060
Genome map
AA seq 291 aa AA seqDB search
MIKKAVLPVAGLGTRFLPASKSIPKEMVTVVDRPAIEYVVREAVEAGIEQIILVTHSSKA
SIENYFDRNFELETTLEQKKKFDLLAEITQIVPEHVSVVSVRQPQPLGLGHAVLCAKSVV
GQDDFAVLLPDVLVKDSSGKNDLSRMIARYNSSQAAQIMVEAVPDHLVDQYGIVDVKHSP
NEGESIAMQGIVEKPAVGSAPSNLSVVGRYVLPAKIMQLLENTPKGAGNEIQLTDAIAML
QETDTVEAYRMQGQTFDCGSKIGYLKAVLHYGVEHPKLGNDFKQLIQELKL
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaagcagttttaccagtagccggtttaggtacacgttttctacccgcaagt
aagtctattccaaaggaaatggttaccgttgttgatcgtcctgcgattgaatatgtagta
cgagaagcggtagaagctggaattgagcaaattattttggttactcattcatcgaaagca
tcaattgaaaattattttgatcgtaactttgagttggaaaccactctagagcaaaagaaa
aaattcgatttacttgcagagattactcaaattgtgcctgagcatgtgagtgtagtaagt
gttagacaacctcagcctttaggcctagggcatgctgttttatgtgcaaagagtgttgtt
ggtcaagatgattttgcagtgctattaccagatgtactagtgaaagatagctctggaaaa
aatgatctatctcgtatgattgctcgctataactcaagccaagctgctcaaatcatggtt
gaggcagtgccagaccatttagtggatcaatatgggattgtggatgtaaaacatagtcca
aatgaaggcgaaagtattgctatgcagggtattgttgaaaagcctgcagtaggctctgca
ccatcaaacttatctgtggttggccgctatgtgttacctgccaagattatgcaattactt
gagaacacgccgaaaggtgcgggtaatgaaattcagttaactgatgcaattgcaatgctt
caagaaacagatactgttgaagcttatcgtatgcaaggtcaaacgtttgattgtggtagt
aagattggctatttaaaagctgtactacactatggagttgaacaccctaagttaggaaat
gattttaaacagttaattcaggaacttaaattatag

DBGET integrated database retrieval system