KEGG   Acinetobacter baumannii ATCC 17978: A1S_0062Help
Entry
A1S_0062          CDS       T00486                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    A1S_0062
   00052 Galactose metabolism
    A1S_0062
   00500 Starch and sucrose metabolism
    A1S_0062
   00520 Amino sugar and nucleotide sugar metabolism
    A1S_0062
Enzymes [BR:acb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     A1S_0062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
73263..74060
Genome map
AA seq 265 aa AA seqDB search
MVTVVDRPAIEYVVREAVEAGIEQIILVTHSSKASIENYFDRNFELETTLEQKKKFDLLA
EITQIVPEHVSVVSVRQPQPLGLGHAVLCAKSVVGQDDFAVLLPDVLVKDSSGKNDLSRM
IARYNSSQAAQIMVEAVPDHLVDQYGIVDVKHSPNEGESIAMQGIVEKPAVGSAPSNLSV
VGRYVLPAKIMQLLENTPKGAGNEIQLTDAIAMLQETDTVEAYRMQGQTFDCGSKIGYLK
AVLHYGVEHPKLGNDFKQLIQELKL
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggttaccgttgttgatcgtcctgcgattgaatatgtagtacgagaagcggtagaagct
ggaattgagcaaattattttggttactcattcatcgaaagcatcaattgaaaattatttt
gatcgtaactttgagttggaaaccactctagagcaaaagaaaaaattcgatttacttgca
gagattactcaaattgtgcctgagcatgtgagtgtagtaagtgttagacaacctcagcct
ttaggcctagggcatgctgttttatgtgcaaagagtgttgttggtcaagatgattttgca
gtgctattaccagatgtactagtgaaagatagctctggaaaaaatgatctatctcgtatg
attgctcgctataactcaagccaagctgctcaaatcatggttgaggcagtgccagaccat
ttagtggatcaatatgggattgtggatgtaaaacatagtccaaatgaaggcgaaagtatt
gctatgcagggtattgttgaaaagcctgcagtaggctctgcaccatcaaacttatctgtg
gttggccgctatgtgttacctgccaagattatgcaattacttgagaacacgccgaaaggt
gcgggtaatgaaattcagttaactgatgcaattgcaatgcttcaagaaacagatactgtt
gaagcttatcgtatgcaaggtcaaacgtttgattgtggtagtaagattggctatttaaaa
gctgtactacactatggagttgaacaccctaagttaggaaatgattttaaacagttaatt
caggaacttaaattatag

DBGET integrated database retrieval system