KEGG   Acinetobacter baumannii ATCC 17978: A1S_0204Help
Entry
A1S_0204          CDS       T00486                                 

Definition
(GenBank) hypothetical protein
  KO
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:acb00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    A1S_0204
Enzymes [BR:acb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     A1S_0204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(227371..228147)
Genome map
AA seq 258 aa AA seqDB search
MKTASVNKHDLMQHAQQDMQKWISDLDLTDRQKLALTCRILFDHGHDAGLAGQITCRSEN
KETFITQRFGLGFDEITASNLLEVNQDLEPINQEGMANPANRFHTWIYKEHPEVNCIIHT
HPTYVAALSMLQIPLMISQMDVCALYEDCSFIGHWPGVPVGNEEGILISSALDKNRAVLL
SHHGQLVTGKTIEEACNLALLIERAAQLQLLAMSAGQIQPIPHALAAEAHDWVSTDKRNK
VNFAYYARKALKKHSDCI
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaagactgcttctgtaaacaaacacgacttgatgcaacacgcacagcaagacatgcaa
aagtggattagcgacttagatttaacagaccgtcaaaagcttgcactgacttgccgtatt
ttatttgatcatgggcatgacgctggtttagcgggtcaaattacatgccgtagtgaaaat
aaagaaacctttattactcaacgtttcggtttaggttttgatgaaattactgcttcaaac
ttgcttgaggtgaatcaggacttagaacccatcaatcaagaaggcatggcaaacccagcc
aaccgtttccacacatggatttataaagaacacccagaggtgaactgtattatccataca
catcctacctatgtagcggccctgtcgatgctacagattccgcttatgatttcccaaatg
gacgtttgcgcactttacgaagactgctcatttataggtcattggccgggagttcctgta
gggaatgaagaaggtattttgatttcttctgctctggataaaaaccgcgctgttttgttg
tctcatcatggtcaattggtcacaggaaaaaccattgaagaagcatgcaacttagctctt
ctaattgaacgcgcagctcaactgcaacttttagccatgtctgccggacaaatccagcct
atcccccacgctttggcagcagaagcccatgattgggtatctaccgataaacgcaacaaa
gtgaactttgcttactacgcacgtaaagctttgaaaaaacattctgactgtatttaa

DBGET integrated database retrieval system