KEGG   Acinetobacter baumannii ATCC 17978: A1S_0263Help
Entry
A1S_0263          CDS       T00486                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:acb00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
288957..289523
Genome map
AA seq 188 aa AA seqDB search
MQYLTQSGLKIDELKYIQWIAVGQATANRLHDYGIEAHVPEVETSEGMLNLPLLHRMQKS
GSVAFWRGEGGRQFMMETLQQQGIQILNFVLYRRQCPQASYSTFKHLTQNSNYNLDKWLV
LITSEASWKYWLELCLKNKAQPDCVYLVLGPRLFQLVKDYRDQQQAHFHIIQLENLSPSG
MIHHIQAL
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatttaacacaaagtggtttaaaaatagatgagctaaaatatattcaatggatt
gcggtggggcaagcgacggctaatcgtcttcacgactatgggattgaagcgcatgttcct
gaggttgaaacttccgagggaatgcttaacttacctctccttcatcgtatgcaaaaatca
ggtagtgtggctttttggagaggtgaaggcggccgtcaatttatgatggaaactttgcaa
cagcaaggaattcagattttaaattttgttctatatcgcaggcagtgtccgcaagcttca
tattcgacattcaaacatctgacacagaattcaaattataatttagataaatggctcgtc
ttaattaccagtgaggcgagctggaaatactggttagagctttgtttaaaaaataaggca
caacctgattgcgtatatttagttttaggaccacgcctttttcaacttgttaaagactat
cgcgatcagcaacaagctcattttcacattattcaacttgaaaatttatcgccttcgggg
atgattcatcacattcaggcattataa

DBGET integrated database retrieval system