KEGG   Acinetobacter baumannii ATCC 17978: A1S_0330Help
Entry
A1S_0330          CDS       T00486                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:acb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A1S_0330
   01230 Biosynthesis of amino acids
    A1S_0330
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A1S_0330
   00051 Fructose and mannose metabolism
    A1S_0330
   00562 Inositol phosphate metabolism
    A1S_0330
Enzymes [BR:acb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     A1S_0330
Exosome [BR:acb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   A1S_0330
  Exosomal proteins of bladder cancer cells
   A1S_0330
  Exosomal proteins of melanoma cells
   A1S_0330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
358247..359041
Genome map
AA seq 264 aa AA seqDB search
MSGSTITPWVVGNWKMNPMRANANQLIEEFKQLLQQNQIADENCHVGVAPVSIALTTVQA
QLQDAARTVYTVAQDVSRVAGTGAYTGEVSAELLKDSQINFVLVGHSERRDIFGDNVEIL
KAKLQNALNAGMTVIYCVGESLEQREQGQAEQVVLQQICDIAPVVTAEQWQNQVVIAYEP
IWAIGTGKTASPQDAQAMHAKIREGLCQLTPAGSNIAILYGGSVKAENAVELAACPDING
ALVGGASLNAASFYQIVQAFAQSK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggttcgacgattacgccttgggtagttggtaactggaaaatgaatccaatgcgt
gccaacgccaaccaacttatagaagaatttaaacaattattgcaacaaaaccaaattgca
gatgaaaactgccatgtgggcgttgcccctgtttctattgctcttacaacggtacaagcg
caattacaggatgctgcaagaacggtatatacggttgcacaggatgtatcacgtgttgct
ggtacaggtgcttatactggtgaagtcagtgcagaactattaaaagatagccaaattaat
ttcgtactggtaggacactctgaacgtcgtgatatttttggtgacaacgttgaaattttg
aaggcaaaactccaaaatgcattaaatgcgggtatgactgtcatttattgtgtgggcgaa
agccttgaacaacgtgagcaaggtcaggccgagcaagttgttctacagcaaatttgtgat
attgcacctgtagtgactgcagaacaatggcaaaaccaagtggttattgcctatgaacct
atttgggcaattggtacaggtaaaacagcttctccgcaagatgcgcaagcgatgcacgct
aaaattcgtgaaggcttatgccaacttacaccagcaggctcaaatattgctattttatat
ggcggtagtgtaaaagctgaaaatgctgttgagttagctgcatgtccagatatcaatggt
gcgttggtgggtggtgcttcattaaatgcagcatctttttatcaaattgtacaagccttc
gcgcaaagcaaataa

DBGET integrated database retrieval system