KEGG   Acinetobacter baumannii ATCC 17978: A1S_0330Help
Entry
A1S_0330          CDS       T00486                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:acb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A1S_0330 (tpiA)
   01230 Biosynthesis of amino acids
    A1S_0330 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A1S_0330 (tpiA)
   00051 Fructose and mannose metabolism
    A1S_0330 (tpiA)
   00562 Inositol phosphate metabolism
    A1S_0330 (tpiA)
Enzymes [BR:acb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     A1S_0330 (tpiA)
Exosome [BR:acb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   A1S_0330 (tpiA)
  Exosomal proteins of bladder cancer cells
   A1S_0330 (tpiA)
  Exosomal proteins of melanoma cells
   A1S_0330 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
358301..359041
Genome map
AA seq 246 aa AA seqDB search
MRANANQLIEEFKQLLQQNQIADENCHVGVAPVSIALTTVQAQLQDAARTVYTVAQDVSR
VAGTGAYTGEVSAELLKDSQINFVLVGHSERRDIFGDNVEILKAKLQNALNAGMTVIYCV
GESLEQREQGQAEQVVLQQICDIAPVVTAEQWQNQVVIAYEPIWAIGTGKTASPQDAQAM
HAKIREGLCQLTPAGSNIAILYGGSVKAENAVELAACPDINGALVGGASLNAASFYQIVQ
AFAQSK
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgccaacgccaaccaacttatagaagaatttaaacaattattgcaacaaaaccaa
attgcagatgaaaactgccatgtgggcgttgcccctgtttctattgctcttacaacggta
caagcgcaattacaggatgctgcaagaacggtatatacggttgcacaggatgtatcacgt
gttgctggtacaggtgcttatactggtgaagtcagtgcagaactattaaaagatagccaa
attaatttcgtactggtaggacactctgaacgtcgtgatatttttggtgacaacgttgaa
attttgaaggcaaaactccaaaatgcattaaatgcgggtatgactgtcatttattgtgtg
ggcgaaagccttgaacaacgtgagcaaggtcaggccgagcaagttgttctacagcaaatt
tgtgatattgcacctgtagtgactgcagaacaatggcaaaaccaagtggttattgcctat
gaacctatttgggcaattggtacaggtaaaacagcttctccgcaagatgcgcaagcgatg
cacgctaaaattcgtgaaggcttatgccaacttacaccagcaggctcaaatattgctatt
ttatatggcggtagtgtaaaagctgaaaatgctgttgagttagctgcatgtccagatatc
aatggtgcgttggtgggtggtgcttcattaaatgcagcatctttttatcaaattgtacaa
gccttcgcgcaaagcaaataa

DBGET integrated database retrieval system