KEGG   Acinetobacter baumannii ATCC 17978: A1S_0358Help
Entry
A1S_0358          CDS       T00486                                 

Definition
(GenBank) exonuclease V alpha subunit
  KO
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:acb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    A1S_0358
Enzymes [BR:acb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     A1S_0358
DNA repair and recombination proteins [BR:acb03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     A1S_0358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
390789..392552
Genome map
AA seq 587 aa AA seqDB search
MDKCVDNLNSPEQSDLSWLMTWSTFLNQAPFTAQTQAPEAAYFLQQLIEASLQGDSCIEI
SPEQIETLGQLVISAEQAKSQVAPCVHDGQGLALYRYWNLEQRLAEQIRRLKQQPIQPVS
CEEHLDLLTDPHQRAALQMVTRQSLSIITGGPGTGKTYTLARIIAVLSQAIPHIRVAMAA
PTGKAAQRMQEALQNSFNDPKLLESGLMSDELRNQSTQTIHRLLGMGHSQTPRFNQKQPL
PYDVIVVDEASMLDLNLATLLFEAVPESCRIILLGDANQLASVDVGAVLADLQQIEALSE
NRVHLQTSRRFAEGALIGQVARFIQMQTGQIDHEQVLQQFEIDIVQVSELRSIPLEADMP
DVVQLEYLPEESPIALETYYQKLMVGFQGYVQSLKAYLQDDRSTEHIENIVKSFDDYRIL
TAVRHGPFGLQQLNQYAERWLQQQLGIVTLGGWYVGRPVMMTYNDYQLGISNGDIGLCFE
HRTQPQQFEVYFPSLNKWVAANRLPKSIQSAFALTIHKSQGSEFTHTAVVLDQAAKNLLS
QELIYTAITRAKKVVSLLVDPEALLQSFTVRTTRKSGLVEKVNRLVR
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
gtggataagtgtgtggacaatctaaatagccctgaacaaagcgatttaagctggttaatg
acttggagtacctttctaaatcaagccccgtttactgcacagacacaagctccagaggca
gcttattttttgcagcagctaattgaagcgagcttgcagggtgacagttgtattgagatt
agcccagagcaaatagaaacacttggccaactggtgatatctgctgaacaagcaaagtct
caagttgccccttgtgtccacgacgggcaggggttggcattataccgatattggaaccta
gagcaacgtctagctgagcaaattcgccgattaaagcaacaaccaattcaacctgtttca
tgtgaagagcatttagacttattaactgatcctcatcagcgagctgctttgcaaatggtg
actcggcagagcttaagtattattacaggtgggccgggtacaggtaagacctatacgctt
gctcgtattattgctgtgcttagtcaggcaattccgcatatccgtgtggcgatggctgct
ccgacgggtaaagctgcacagcgtatgcaagaagccttacaaaactcgtttaatgatccc
aaactgcttgagtcggggctaatgagtgatgagctaagaaatcaaagtacccaaactatc
catcgattattaggtatggggcatagtcaaactccacggtttaatcaaaaacagcctttg
ccttatgacgttattgtggtggatgaagcctctatgctggacttaaatctggcaacgtta
ttatttgaagcggtccctgagtcttgccgaattattttattaggtgatgccaaccagctt
gcttctgtagacgtcggagctgtacttgcagatttacagcaaatcgaggctttgtctgaa
aaccgtgttcaccttcaaaccagccgtcgttttgcggaaggggctttgattggtcaggta
gcccgatttattcaaatgcaaactggtcaaattgaccatgagcaagttttacaacaattt
gaaatcgatattgttcaggtttcagagctacgttcaattcctttagaagctgatatgccc
gatgtggttcagcttgaatatttacccgaagagtcccctatagcgctagaaacttactac
caaaaattgatggtgggttttcaaggctatgtgcaaagcttaaaagcttatttacaagat
gatcgttcaactgaacatattgaaaatatcgttaagtcattcgatgactaccgtatttta
actgccgtacgtcatggaccatttggtttgcagcaactcaatcaatatgccgaacgctgg
ttacaacaacaactaggtattgtgactttaggaggatggtatgttggccgtccggttatg
atgacttataacgattaccagcttggcatttcaaatggtgacattggtttatgttttgaa
catagaacccagccgcaacagtttgaagtgtatttcccaagtttaaataagtgggttgct
gcaaatcggctacctaaaagtattcaaagtgcatttgccttaacaattcacaaatcacaa
ggttctgaatttacccatacagctgttgttcttgatcaggctgccaagaatttgttaagc
caggagttgatctacactgcgattacacgagccaaaaaagtagtgagtttattggtcgat
ccagaggcgttactccaatcctttacagttcgcacgacaagaaaaagcggtttagttgaa
aaagttaatcggttagttcgttaa

DBGET integrated database retrieval system