KEGG   Acinetobacter baumannii ATCC 17978: A1S_0358Help
Entry
A1S_0358          CDS       T00486                                 

Definition
exonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:acb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    A1S_0358
Enzymes [BR:acb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     A1S_0358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
391002..392552
Genome map
AA seq 516 aa AA seqDB search
MISAEQAKSQVAPCVHDGQGLALYRYWNLEQRLAEQIRRLKQQPIQPVSCEEHLDLLTDP
HQRAALQMVTRQSLSIITGGPGTGKTYTLARIIAVLSQAIPHIRVAMAAPTGKAAQRMQE
ALQNSFNDPKLLESGLMSDELRNQSTQTIHRLLGMGHSQTPRFNQKQPLPYDVIVVDEAS
MLDLNLATLLFEAVPESCRIILLGDANQLASVDVGAVLADLQQIEALSENRVHLQTSRRF
AEGALIGQVARFIQMQTGQIDHEQVLQQFEIDIVQVSELRSIPLEADMPDVVQLEYLPEE
SPIALETYYQKLMVGFQGYVQSLKAYLQDDRSTEHIENIVKSFDDYRILTAVRHGPFGLQ
QLNQYAERWLQQQLGIVTLGGWYVGRPVMMTYNDYQLGISNGDIGLCFEHRTQPQQFEVY
FPSLNKWVAANRLPKSIQSAFALTIHKSQGSEFTHTAVVLDQAAKNLLSQELIYTAITRA
KKVVSLLVDPEALLQSFTVRTTRKSGLVEKVNRLVR
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
gtgatatctgctgaacaagcaaagtctcaagttgccccttgtgtccacgacgggcagggg
ttggcattataccgatattggaacctagagcaacgtctagctgagcaaattcgccgatta
aagcaacaaccaattcaacctgtttcatgtgaagagcatttagacttattaactgatcct
catcagcgagctgctttgcaaatggtgactcggcagagcttaagtattattacaggtggg
ccgggtacaggtaagacctatacgcttgctcgtattattgctgtgcttagtcaggcaatt
ccgcatatccgtgtggcgatggctgctccgacgggtaaagctgcacagcgtatgcaagaa
gccttacaaaactcgtttaatgatcccaaactgcttgagtcggggctaatgagtgatgag
ctaagaaatcaaagtacccaaactatccatcgattattaggtatggggcatagtcaaact
ccacggtttaatcaaaaacagcctttgccttatgacgttattgtggtggatgaagcctct
atgctggacttaaatctggcaacgttattatttgaagcggtccctgagtcttgccgaatt
attttattaggtgatgccaaccagcttgcttctgtagacgtcggagctgtacttgcagat
ttacagcaaatcgaggctttgtctgaaaaccgtgttcaccttcaaaccagccgtcgtttt
gcggaaggggctttgattggtcaggtagcccgatttattcaaatgcaaactggtcaaatt
gaccatgagcaagttttacaacaatttgaaatcgatattgttcaggtttcagagctacgt
tcaattcctttagaagctgatatgcccgatgtggttcagcttgaatatttacccgaagag
tcccctatagcgctagaaacttactaccaaaaattgatggtgggttttcaaggctatgtg
caaagcttaaaagcttatttacaagatgatcgttcaactgaacatattgaaaatatcgtt
aagtcattcgatgactaccgtattttaactgccgtacgtcatggaccatttggtttgcag
caactcaatcaatatgccgaacgctggttacaacaacaactaggtattgtgactttagga
ggatggtatgttggccgtccggttatgatgacttataacgattaccagcttggcatttca
aatggtgacattggtttatgttttgaacatagaacccagccgcaacagtttgaagtgtat
ttcccaagtttaaataagtgggttgctgcaaatcggctacctaaaagtattcaaagtgca
tttgccttaacaattcacaaatcacaaggttctgaatttacccatacagctgttgttctt
gatcaggctgccaagaatttgttaagccaggagttgatctacactgcgattacacgagcc
aaaaaagtagtgagtttattggtcgatccagaggcgttactccaatcctttacagttcgc
acgacaagaaaaagcggtttagttgaaaaagttaatcggttagttcgttaa

DBGET integrated database retrieval system