KEGG   Acinetobacter baumannii ATCC 17978: A1S_0457Help
Entry
A1S_0457          CDS       T00486                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:acb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    A1S_0457
   00670 One carbon pool by folate
    A1S_0457
Enzymes [BR:acb01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     A1S_0457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(494601..495071)
Genome map
AA seq 156 aa AA seqDB search
MDKNHCIGKGNALPWHISADLKHFKEITQGGVVIMGRKTLESMGRALPNRVNWVITRDIN
WHFDGVKIAYSIEDALNAALEDAKNTEKQALFIIGGGEIFKQTLSIADRLELTHVDLDVQ
GDAHYPTIPSEFHKTASEQQVDEKSGTSFEFATYKK
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaaatcactgtattggtaaaggcaatgcgttgccatggcatatctctgccgac
ttaaaacactttaaagaaatcacacaaggtggtgtggtgatcatgggccgcaaaacgctt
gagtctatgggccgtgctctaccgaaccgtgtgaactgggtaattacccgtgacattaac
tggcattttgacggcgtaaaaattgcgtattcaattgaagatgctttaaatgctgcttta
gaagatgccaaaaacaccgaaaagcaagctttattcattattggtggtggtgaaatcttt
aagcaaaccttgtcaattgcagaccgtcttgagctcactcatgttgacttagatgtacaa
ggtgatgcacattatccaacaataccgagtgaatttcacaaaactgcaagcgaacagcaa
gtagatgaaaaatcaggaacttcattcgaatttgccacttataaaaaataa

DBGET integrated database retrieval system