KEGG   Acinetobacter baumannii ATCC 17978: A1S_0584Help
Entry
A1S_0584          CDS       T00486                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:acb00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
634035..634388
Genome map
AA seq 117 aa AA seqDB search
MGPQDQPNYLNAVAQLKTELLPLDLLDQLQRFEQEAGRVRLRHWGERTLDLDLLIYGNEK
IQNERLTVPHVGILQRDFVVIPLLDLDAGLHINDQPLKNLELIQQPTLTVLADESWA
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgggtccccaagatcagccgaattatctaaatgcagtcgctcagctaaaaaccgaatta
cttccgctggacttacttgaccagttacagcgttttgagcaggaagctgggcgggtgaga
ctccgtcattggggggagcgaactctagatcttgatctactaatttatggcaatgaaaaa
atacaaaatgagcgcttaacggtgccgcatgtaggaatattacaacgagattttgttgtg
attcctttattagatttagatgctggtctacatattaatgatcagccacttaaaaattta
gaactcatacagcagccaacgctgactgtacttgctgatgagtcttgggcttaa

DBGET integrated database retrieval system