KEGG   Acinetobacter baumannii ATCC 17978: A1S_0584Help
Entry
A1S_0584          CDS       T00486                                 

Definition
(GenBank) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  KO
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:acb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    A1S_0584
Enzymes [BR:acb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     A1S_0584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
633906..634388
Genome map
AA seq 160 aa AA seqDB search
MTVTTYIGLGSNLGDSRQILSEAITKLKSLGEVKVSKLYQSPPMGPQDQPNYLNAVAQLK
TELLPLDLLDQLQRFEQEAGRVRLRHWGERTLDLDLLIYGNEKIQNERLTVPHVGILQRD
FVVIPLLDLDAGLHINDQPLKNLELIQQPTLTVLADESWA
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacagtaaccacatatattggcttaggaagtaacctaggtgattcacgccagattcta
tctgaagcgataaccaaacttaaatctcttggtgaagtgaaagtatctaaactttaccaa
agtccccctatgggtccccaagatcagccgaattatctaaatgcagtcgctcagctaaaa
accgaattacttccgctggacttacttgaccagttacagcgttttgagcaggaagctggg
cgggtgagactccgtcattggggggagcgaactctagatcttgatctactaatttatggc
aatgaaaaaatacaaaatgagcgcttaacggtgccgcatgtaggaatattacaacgagat
tttgttgtgattcctttattagatttagatgctggtctacatattaatgatcagccactt
aaaaatttagaactcatacagcagccaacgctgactgtacttgctgatgagtcttgggct
taa

DBGET integrated database retrieval system