KEGG   Acinetobacter baumannii ATCC 17978: A1S_0687Help
Entry
A1S_0687          CDS       T00486                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:acb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    A1S_0687
  Amino acid metabolism
   00340 Histidine metabolism
    A1S_0687
Enzymes [BR:acb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     A1S_0687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
817264..818352
Genome map
AA seq 362 aa AA seqDB search
MSQQQLKAAFDGLNQEIREALQLAADRIRTFHEAQKQDSWTYVDDLGNTLGQKVTPLDRV
GIYVPGGLASYPSSVLMNAVPAHVAGVPEIIMVVPAPNGELNPLVLAAAYLAGVSRVFTI
GGAQAVAALAYGTQTVPRVDKITGPGNRFVAAAKRAVFGQVGIDMIAGPSEILVYAEGVN
NAEWLAMDVLSQAEHDTVAQAIFITPDEALLEAVESAIEKHLNELPKAEIARTSIENRGA
LVLVKDRAEAVDLINQVAPEHLELCLDDAEAMSQDIRHAGAIFMGRYTPEAIGDYCAGPN
HVLPTSGTARFSSPLGVYDFQKRSSLIMCSKDGVKTLAKTADVLAVQENLDAHARSARYR
YQ
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
ttgtctcaacaacaacttaaagctgcttttgatggtttaaatcaagagattcgtgaagcc
ctgcaacttgcagctgatcgtattcgtacttttcatgaagctcaaaaacaagatagctgg
acttatgtagatgatttgggtaataccctaggacaaaaagtgacgccacttgatcgtgtt
ggtatttatgtaccaggcggacttgcatcttatccttcatctgtacttatgaatgcggta
ccagcacatgtggccggtgtacctgaaattattatggttgtgccagcgccaaatggtgaa
ctaaatccactcgttttagctgccgcctatctagcaggtgttagccgagtatttaccatt
ggtggggcacaagctgttgctgctttagcttatggtactcaaactgttccacgtgttgat
aaaattacgggtcctggaaaccgatttgtggcagctgctaaacgtgctgtatttggtcag
gtgggtatcgacatgattgctggaccttctgaaatattagtttatgcagaaggtgtgaat
aatgctgaatggttagcgatggatgtattatctcaggctgaacatgacacagtagctcaa
gctattttcattactccagatgaagcattattagaagcagtagagtctgcaattgagaaa
catttaaatgaattgcctaaagctgagattgcgcgtacatcgattgaaaatcgtggtgca
ttagttttggtaaaagaccgtgctgaagcagttgatttgattaatcaggttgcaccagag
catttggaactatgtcttgatgatgctgaagcgatgagccaagatattcgtcatgcaggg
gcaatttttatggggcgctatacacctgaagcaattggtgattattgtgctggcccaaac
cacgtattaccgacatcaggcacagctcgtttctcttcgccacttggtgtatatgatttt
caaaagcgctctagtttgatcatgtgttcaaaagatggcgttaagactttggctaaaaca
gctgatgtacttgctgttcaagaaaatctcgatgcccatgcacgctcggcgcgttatcgt
tatcaataa

DBGET integrated database retrieval system