KEGG   Acinetobacter baumannii ATCC 17978: A1S_0773Help
Entry
A1S_0773          CDS       T00486                                 

Definition
(GenBank) putative D-cysteine desulfhydrase (DcyD)
  KO
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:acb00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    A1S_0773
Enzymes [BR:acb01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     A1S_0773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(916012..916722)
Genome map
AA seq 236 aa AA seqDB search
MTFGGAYSNHIAATAYAAHLFGLKSIGIIRGEELAGKPLNPTLAKAQSLGMQLHFVSRHE
YRLRDDANYLQQLQQQFPQTYIIPEGGTNELAVQGCQEILSQYDLDQYDVICCAVGTGGT
ISGLIERSAAHQKVLGFSALKGDFLQQAIRQWTKKQNWSLTDVYCWGGYAKTSPELFAFI
ENFEEQYTVPLEPIYTGKMMFGLFDLIKNNYFPANTRILAIHSGGLQADIRNKPHT
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
ttgacttttggtggggcttactcaaatcatattgctgcaacagcttatgcagctcatctt
tttggtttaaaaagtataggaattattcgtggtgaagagttagctggtaaaccacttaat
cccaccttggcaaaagctcaaagtttaggaatgcagctacattttgtctctcgccatgaa
tatcgcttacgagatgatgcaaattaccttcaacaattacagcaacaatttccgcagacc
tatatcattcccgaaggtggaaccaatgaactggcagttcaaggttgtcaggaaatcctg
agccaatatgacttagatcaatatgatgtgatttgctgtgcagtcggaactggcggaacg
atttcaggtctgattgaaagaagtgcagcacatcagaaagtcttaggattttcggcttta
aaaggtgatttcttacaacaagcgattaggcaatggactaaaaaacaaaattggtctttg
acagatgtatactgctggggcggttatgcgaaaacctcacctgaactattcgcatttatt
gaaaattttgaagagcaatatacggtcccccttgaaccgatctataccggaaaaatgatg
tttggtctgtttgatcttataaaaaacaattattttccagcgaatacacgcattttggca
attcattccggtggtttacaagccgatattagaaataaacctcacacataa

DBGET integrated database retrieval system