KEGG   Acinetobacter baumannii ATCC 17978: A1S_0773Help
Entry
A1S_0773          CDS       T00486                                 

Definition
D-cysteine desulfhydrase (DcyD)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:acb00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(916012..916572)
Genome map
AA seq 186 aa AA seqDB search
MQLHFVSRHEYRLRDDANYLQQLQQQFPQTYIIPEGGTNELAVQGCQEILSQYDLDQYDV
ICCAVGTGGTISGLIERSAAHQKVLGFSALKGDFLQQAIRQWTKKQNWSLTDVYCWGGYA
KTSPELFAFIENFEEQYTVPLEPIYTGKMMFGLFDLIKNNYFPANTRILAIHSGGLQADI
RNKPHT
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgcagctacattttgtctctcgccatgaatatcgcttacgagatgatgcaaattacctt
caacaattacagcaacaatttccgcagacctatatcattcccgaaggtggaaccaatgaa
ctggcagttcaaggttgtcaggaaatcctgagccaatatgacttagatcaatatgatgtg
atttgctgtgcagtcggaactggcggaacgatttcaggtctgattgaaagaagtgcagca
catcagaaagtcttaggattttcggctttaaaaggtgatttcttacaacaagcgattagg
caatggactaaaaaacaaaattggtctttgacagatgtatactgctggggcggttatgcg
aaaacctcacctgaactattcgcatttattgaaaattttgaagagcaatatacggtcccc
cttgaaccgatctataccggaaaaatgatgtttggtctgtttgatcttataaaaaacaat
tattttccagcgaatacacgcattttggcaattcattccggtggtttacaagccgatatt
agaaataaacctcacacataa

DBGET integrated database retrieval system