KEGG   Acinetobacter baumannii ATCC 17978: A1S_0834Help
Entry
A1S_0834          CDS       T00486                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:acb00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(976104..976820)
Genome map
AA seq 238 aa AA seqDB search
MTFTPISEDEIQIEGLGEVQLEQNLIYRAAQILRPHAQNPCGLHIKIEKNIPMGAGLGGG
SSNAATTLIVLNQLWQCGLTEEQLAQFGVKLGADVPIFIYGLNAWAEGIGEHLSFIDLDQ
KQFIVLKPDCFISTQLLFSQKTLTRDSKPTTFCAYQLEPSNFGNNFEPLARELYPEVEEA
MQYLDQFGHAKLTGTGACVFAEVTDEMNVDDILKHAPCKAYLVHSLKESPLRHFKVAS
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgacatttacgcctatatctgaagatgagattcagattgaaggtttaggtgaggttcaa
cttgagcaaaatctgatttatcgggcggcacagatattacgccctcacgctcaaaatcct
tgcggactccatataaaaattgaaaaaaatattccgatgggtgctggtttaggtggcggt
tcttccaatgcagcaacgacgcttattgtcttaaatcaattatggcaatgtggtctaact
gaagaacaattagctcagttcggtgtcaagcttggtgccgatgttccaatttttatttat
gggttaaatgcatgggctgaagggattggtgaacatttatcattcatagacttagatcaa
aaacaattcattgttttaaaacctgattgttttatcagcactcaactgcttttttcacaa
aaaacattgacaagagattctaagcccactacattttgcgcctatcagttagaaccttct
aatttcggaaataactttgagcctttggctagagagttataccctgaagttgaagaagca
atgcaatatctcgatcagtttggtcatgcaaagcttacaggtacaggtgcttgtgttttt
gctgaggtaaccgatgaaatgaatgttgatgacattcttaaacatgcaccatgtaaagct
tacttggtacatagtttaaaagaatctcctttacgtcattttaaagttgcaagttag

DBGET integrated database retrieval system