KEGG   Acinetobacter baumannii ATCC 17978: A1S_0834Help
Entry
A1S_0834          CDS       T00486                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:acb00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A1S_0834
Enzymes [BR:acb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     A1S_0834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(976104..976937)
Genome map
AA seq 277 aa AA seqDB search
MIRVPSPAKLNLFLHITGRRENGYHELQTIFQLIDLYDWMTFTPISEDEIQIEGLGEVQL
EQNLIYRAAQILRPHAQNPCGLHIKIEKNIPMGAGLGGGSSNAATTLIVLNQLWQCGLTE
EQLAQFGVKLGADVPIFIYGLNAWAEGIGEHLSFIDLDQKQFIVLKPDCFISTQLLFSQK
TLTRDSKPTTFCAYQLEPSNFGNNFEPLARELYPEVEEAMQYLDQFGHAKLTGTGACVFA
EVTDEMNVDDILKHAPCKAYLVHSLKESPLRHFKVAS
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgattcgagtaccttctccagctaagctcaacctgtttttgcatatcacaggacgtcgt
gaaaatggttaccatgaactacaaaccattttccaacttattgatttatatgactggatg
acatttacgcctatatctgaagatgagattcagattgaaggtttaggtgaggttcaactt
gagcaaaatctgatttatcgggcggcacagatattacgccctcacgctcaaaatccttgc
ggactccatataaaaattgaaaaaaatattccgatgggtgctggtttaggtggcggttct
tccaatgcagcaacgacgcttattgtcttaaatcaattatggcaatgtggtctaactgaa
gaacaattagctcagttcggtgtcaagcttggtgccgatgttccaatttttatttatggg
ttaaatgcatgggctgaagggattggtgaacatttatcattcatagacttagatcaaaaa
caattcattgttttaaaacctgattgttttatcagcactcaactgcttttttcacaaaaa
acattgacaagagattctaagcccactacattttgcgcctatcagttagaaccttctaat
ttcggaaataactttgagcctttggctagagagttataccctgaagttgaagaagcaatg
caatatctcgatcagtttggtcatgcaaagcttacaggtacaggtgcttgtgtttttgct
gaggtaaccgatgaaatgaatgttgatgacattcttaaacatgcaccatgtaaagcttac
ttggtacatagtttaaaagaatctcctttacgtcattttaaagttgcaagttag

DBGET integrated database retrieval system