KEGG   Acinetobacter baumannii ATCC 17978: A1S_0887Help
Entry
A1S_0887          CDS       T00486                                 

Definition
(GenBank) phosphomannomutase
  KO
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:acb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A1S_0887
   00030 Pentose phosphate pathway
    A1S_0887
   00051 Fructose and mannose metabolism
    A1S_0887
   00052 Galactose metabolism
    A1S_0887
   00500 Starch and sucrose metabolism
    A1S_0887
   00520 Amino sugar and nucleotide sugar metabolism
    A1S_0887
  Nucleotide metabolism
   00230 Purine metabolism
    A1S_0887
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    A1S_0887
Enzymes [BR:acb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     A1S_0887
    5.4.2.8  phosphomannomutase
     A1S_0887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1029093..1030511
Genome map
AA seq 472 aa AA seqDB search
MNVRHSFPKNIFRAYDIRGKLSYLTTDVVRSIAYGLAQQYKQAEQTQLIIGYDARLTSPA
YAHLIEEILVEQGLNVTNIGCCSTPMMYYIAREFGGNGIMVTASHNPKSDNGIKWILRGE
PPSPEMIQQVGEFAQTYVPTHTISLLELSTPQFNSEFCKKYQQAIFNDIQLKRPLKVVLD
GLHGSAGHCSKLVLEKMGCEVIALRTTPNGEFPDHAPDPSHAAHLKELRKTIIEQGADIG
IALDGDGDRVVLLDEKANILTADRLLSLFAQMCLEQQPDKEIVFDVKCSLMVQRTVERLG
GKPKMIRTGSSFLRAYLSQSNGNAIFGGEYAGHYVFNDGRGFGYDDGLYAALRVMEYFTE
SSAATISDLFSNYPERCCTEDTYIGTHHSDPKHVLQDIEILSHRLGARISKIDGVRLDFD
DGFGIIRASNTGEYFTVRFDADNPLRLKEIQQKFIDMLQERYPQIAQELSEA
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtaagacactcatttccaaaaaatattttccgtgcttacgatattagaggcaaa
ctttcttatttaactacggacgtcgtccgttcaattgcctatggattggcacaacaatat
aaacaagcagaacaaactcagctgattattggttatgatgcacgcctgacgagtccggct
tatgcgcatttaatcgaagagatattagtagagcagggtttaaatgttacaaatattggt
tgttgctcaaccccgatgatgtactacattgcacgggagtttggtggtaatggcataatg
gtaacagctagccataatcctaaatcagataatggtattaaatggattttaagaggtgaa
cctccatctcctgaaatgatccagcaagtaggtgaatttgcgcaaacttatgtacctact
catacaatttcattattagaattatcaactcctcaatttaattcagaattttgtaaaaaa
taccaacaagcaatctttaacgatattcaactcaagcgtcctttaaaagttgtattagat
ggcctgcatggatcggcagggcattgctcaaaactcgtacttgaaaaaatgggttgtgaa
gtcattgctttacgtacgactccaaatggtgagttccctgatcacgcaccagacccttca
catgctgcgcatttaaaagaactacgtaaaacgattattgaacagggggcagatattggt
attgcccttgatggcgatggcgaccgtgtcgtattacttgatgaaaaagccaatatactt
accgctgaccgtttattgtcactatttgcacaaatgtgtctggagcagcaaccagacaaa
gaaattgtatttgatgtgaaatgctcactcatggttcaaagaaccgtagaacgacttggt
ggtaaacccaaaatgattcgcacgggaagtagcttcctccgcgcgtatttatctcaatca
aatggtaacgctatttttgggggcgaatacgcgggtcattatgtatttaatgatgggcgt
ggttttgggtatgacgatggtttgtacgctgcattacgtgtaatggaatatttcactgag
tcgagtgcggcaacaatttctgatttattttctaattatcctgaaagatgctgtaccgaa
gatacttatattggtacccatcattccgaccctaaacatgtactacaagatattgaaatt
ttaagccatcgtttgggtgctcgaattagtaaaattgatggcgtacgtcttgattttgat
gatggttttggcattattcgagcatcaaatacaggtgagtattttaccgtaagatttgac
gctgataatcctttacgtttaaaggaaatccagcaaaaatttattgatatgttgcaagag
cgttatccgcaaattgcacaagaactttctgaggcctaa

DBGET integrated database retrieval system