KEGG   Acinetobacter baumannii ATCC 17978: A1S_0965Help
Entry
A1S_0965          CDS       T00486                                 

Definition
mutarotase precursor
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:acb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A1S_0965
   00052 Galactose metabolism
    A1S_0965
Enzymes [BR:acb01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     A1S_0965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1115598..1116620)
Genome map
AA seq 340 aa AA seqDB search
MSNNNGVSVSFISFGGVITQILTPDAQGKQNNIVLGFDDLKGYEVTDTKEGIHFGGLIGR
YANRIGNAKFSLDGKTYNLEKNNGPNSLHSGNPGFDKRVWQVKPLVSQGETVKASLKLTS
PNGDQGFPGKLDVEVIYSLSDQNEFKIEYKAKTDQPTVVNLTNHSYFNLSGAGNNPYGVL
DHVVQLNADRILVTDQNSLPTGEIASVAGTPFDFRTPKAIVKDIRANNQQLAYGYGYDQT
WVINQKSQGKLNLAAIVVDPKSKRTMQVLTTEPSVQMYTANHLLGNIVGANGVLYRQADA
LALETQHFPDSPNQPAFPSTRLNPNQTYNSITVFKFGVQK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagtaataacaatggagtctcggtatcttttattagttttggtggtgtaattacacaa
atcttgactcccgatgcccaaggcaaacaaaataatatcgttttgggctttgatgactta
aaaggctatgaagtcactgataccaaggaaggtattcattttggcggattaattggtcgt
tatgcgaaccgaattggcaatgctaaatttagcttagatggaaaaacgtataacctcgaa
aaaaataatggcccgaactcattacatagcggcaatcctggttttgataaacgtgtttgg
caagttaagcccctcgtttctcaaggtgaaaccgttaaagcttctcttaagttaaccagt
ccaaatggtgatcaaggttttcccggaaagttagatgtggaagtaatctacagtctttca
gatcaaaatgaatttaagattgaatataaagccaaaactgatcagcctacagtcgtcaac
ctcaccaaccacagttatttcaacttgtcaggagctggtaataatccttatggtgtgctg
gatcatgtggtacaactcaatgcagaccgtatattggtaaccgatcaaaactctttacca
acaggtgaaattgcttcagttgcaggtacaccttttgattttcgaacgcctaaagcaatc
gtaaaagacatccgagcaaataatcagcaattggcctatggatatggctatgaccaaact
tgggtaattaatcaaaagtctcaagggaaactcaatcttgcagctattgtggttgatcca
aaatctaaacggaccatgcaagtcttaacgactgaaccaagcgtccaaatgtatacagcc
aatcatttattaggaaatatagttggcgcaaatggcgtactctaccgacaagcagacgca
ctagcattagaaacacagcattttccagacagcccgaatcaaccggctttcccgtctaca
cgtttaaacccaaatcaaacttataacagtattaccgtatttaagtttggtgttcaaaaa
tag

  All links  
No link information was found.   
DBGET integrated database retrieval system