KEGG   Acinetobacter baumannii ATCC 17978: A1S_0985Help
Entry
A1S_0985          CDS       T00486                                 

Definition
hypothetical protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:acb01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1141931..1142500)
Genome map
AA seq 189 aa AA seqDB search
MLPMFVSAKTILILGDSISAGYGIDPEQGWVQLLQKRLDQQYPKQHKVVNASVSGETTSG
ALARLPKLLQTYKPEVVVIELGGNDGLRGQPPQMIQKNLSQLIQLSQKQKAKVILFGMKI
PPNYGTAYSKAFENNYKTVSQKYQVKLLPFFLDGVAGQKQLMQNDLIHPNAQAQSKLLNL
AYPYIKGAL
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgttgcccatgttcgtctcggcaaaaactattttaattttaggagatagtattagtgcc
ggttatggaatagaccctgaacaaggttgggtacaattactacaaaaacgtttagaccaa
cagtatcccaaacaacataaagtggtcaatgcaagtgtgagtggggaaaccactagcggc
gctttggcacgattaccaaaacttttacaaacttataaacccgaggtcgttgttattgaa
ttaggcgggaatgatggcttacgtggacaaccaccacaaatgattcaaaaaaatctgtct
cagctcattcaattaagccagaagcaaaaagccaaggttattctttttggtatgaagatt
ccgcccaattatggcacggcttatagcaaagcattcgaaaataactacaaaactgtaagt
caaaaatatcaggtgaaattgctaccattttttcttgatggcgtcgctgggcaaaagcaa
ctaatgcaaaatgacttgattcatccaaatgcccaagcacaatcaaaattactgaattta
gcttacccatacataaaaggtgccctatag

DBGET integrated database retrieval system