KEGG   Acinetobacter baumannii ATCC 17978: A1S_1008Help
Entry
A1S_1008          CDS       T00486                                 

Definition
(RefSeq) isocitrate lyase (EC:4.1.3.1)
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:acb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A1S_1008
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    A1S_1008
Enzymes [BR:acb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     A1S_1008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1167907..1169415
Genome map
AA seq 502 aa AA seqDB search
MQLQNRFKTGLDIAKYTAAIMRRDMAEYDADSSKYTQSLGCWHGFIAQQKMIANKKYFGT
TSKRYIYLSGWMVAALRSEFGPLPDQSMHEKTSVPALIEEIYTFLRQADAKELNDLFRAL
NKAKEAGDSAKVAEITAQIDNFETHVVPIIADIDAGFGNEEATYLLAKKMIEAGACALQI
ENQVSDAKQCGHQAGKVTVPHEDFIAKIHALRYAFLEMGVEDGVIVARTDSEGADLTQKI
PVVKEPGDIASKYISYLDTQEIDISEAQEDEILIKRDGKLHRPTRLASGLYQFREGTQID
RVVLDCITSLQNGADLLWIETPTPNVQEIAHMVNRVKEVVPNAKLVYNNSPSFNWTLNFR
QQAYDRWVAEGKDVSAYDRAKLMSAEYDNTELAAEADEKIRTFQADAAREAGVFHHLITL
PTYHTAALSTHELAQGYFGDQGMLAYVAGVQRKEIRGGIACVKHQAMAGSDIGDDHKEIF
AGENALKAGDDAKNTMNQFSAH
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgcaacttcaaaaccgtttcaaaacaggtttagatattgctaagtatacagctgcgatt
atgcgtcgtgatatggctgaatacgatgctgattcaagcaaatatactcaatcattaggt
tgctggcatggtttcatcgctcaacaaaaaatgattgctaacaaaaagtatttcggtacg
acaagcaaacgttatatctacctttctggttggatggttgctgctcttcgttcagaattt
ggtccacttcctgaccaatctatgcacgagaaaacttcagtacctgctttgatcgaagaa
atctacactttcttacgtcaagctgatgcaaaagaattaaatgacttgttccgtgcttta
aataaagcaaaagaagctggtgattctgcgaaagtagctgaaatcacagctcaaatcgac
aacttcgaaactcatgttgtgccaattattgcagacatcgatgctggtttcggtaacgaa
gaagcaacttacttacttgctaagaaaatgattgaagctggtgcttgtgcgcttcaaatc
gaaaaccaagtatctgatgcaaaacaatgtggtcaccaagctggtaaagtaactgttcca
catgaagacttcatcgctaagatccatgcacttcgttatgcattcttagaaatgggtgtt
gaagacggtgttatcgttgctcgtactgactctgaaggcgctgacttaactcagaagatc
cctgtagttaaagagccaggcgatatcgcatctaaatatattagctacttagatactcaa
gaaattgatatctcagaagctcaagaagatgagatcttaattaaacgtgatggtaaatta
catcgtccaactcgtttagcttctggtctataccaattccgtgaaggcactcagattgac
cgtgttgtacttgactgtatcactagccttcaaaacggtgctgacttactttggatcgaa
actccgactccaaacgtacaagaaatagcacacatggttaaccgtgtaaaagaagtagtt
ccgaatgcgaagcttgtttataacaacagcccatcattcaactggactttaaacttccgt
caacaagcgtacgatcgttgggttgcagaaggtaaagatgtatctgcttacgaccgtgct
aaattaatgagcgctgagtacgacaatactgaattagctgctgaagctgatgaaaaaatc
cgtactttccaagcagatgctgcgcgtgaagctggtgtgttccatcacttgatcacactt
cctacataccacactgctgctctttctactcatgaattagcacaaggttacttcggtgac
caaggtatgttagcttatgttgctggcgtacaacgtaaagaaatccgtggcggtatcgca
tgtgtgaaacaccaagcaatggctggttctgacatcggtgatgaccacaaagaaatcttc
gctggtgaaaatgcacttaaagctggtgacgatgctaaaaacacaatgaaccaattctca
gctcactaa

DBGET integrated database retrieval system