KEGG   Acinetobacter baumannii ATCC 17978: A1S_1008Help
Entry
A1S_1008          CDS       T00486                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:acb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A1S_1008
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    A1S_1008
Enzymes [BR:acb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     A1S_1008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1167907..1169415
Genome map
AA seq 502 aa AA seqDB search
MQLQNRFKTGLDIAKYTAAIMRRDMAEYDADSSKYTQSLGCWHGFIAQQKMIANKKYFGT
TSKRYIYLSGWMVAALRSEFGPLPDQSMHEKTSVPALIEEIYTFLRQADAKELNDLFRAL
NKAKEAGDSAKVAEITAQIDNFETHVVPIIADIDAGFGNEEATYLLAKKMIEAGACALQI
ENQVSDAKQCGHQAGKVTVPHEDFIAKIHALRYAFLEMGVEDGVIVARTDSEGADLTQKI
PVVKEPGDIASKYISYLDTQEIDISEAQEDEILIKRDGKLHRPTRLASGLYQFREGTQID
RVVLDCITSLQNGADLLWIETPTPNVQEIAHMVNRVKEVVPNAKLVYNNSPSFNWTLNFR
QQAYDRWVAEGKDVSAYDRAKLMSAEYDNTELAAEADEKIRTFQADAAREAGVFHHLITL
PTYHTAALSTHELAQGYFGDQGMLAYVAGVQRKEIRGGIACVKHQAMAGSDIGDDHKEIF
AGENALKAGDDAKNTMNQFSAH
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgcaacttcaaaaccgtttcaaaacaggtttagatattgctaagtatacagctgcgatt
atgcgtcgtgatatggctgaatacgatgctgattcaagcaaatatactcaatcattaggt
tgctggcatggtttcatcgctcaacaaaaaatgattgctaacaaaaagtatttcggtacg
acaagcaaacgttatatctacctttctggttggatggttgctgctcttcgttcagaattt
ggtccacttcctgaccaatctatgcacgagaaaacttcagtacctgctttgatcgaagaa
atctacactttcttacgtcaagctgatgcaaaagaattaaatgacttgttccgtgcttta
aataaagcaaaagaagctggtgattctgcgaaagtagctgaaatcacagctcaaatcgac
aacttcgaaactcatgttgtgccaattattgcagacatcgatgctggtttcggtaacgaa
gaagcaacttacttacttgctaagaaaatgattgaagctggtgcttgtgcgcttcaaatc
gaaaaccaagtatctgatgcaaaacaatgtggtcaccaagctggtaaagtaactgttcca
catgaagacttcatcgctaagatccatgcacttcgttatgcattcttagaaatgggtgtt
gaagacggtgttatcgttgctcgtactgactctgaaggcgctgacttaactcagaagatc
cctgtagttaaagagccaggcgatatcgcatctaaatatattagctacttagatactcaa
gaaattgatatctcagaagctcaagaagatgagatcttaattaaacgtgatggtaaatta
catcgtccaactcgtttagcttctggtctataccaattccgtgaaggcactcagattgac
cgtgttgtacttgactgtatcactagccttcaaaacggtgctgacttactttggatcgaa
actccgactccaaacgtacaagaaatagcacacatggttaaccgtgtaaaagaagtagtt
ccgaatgcgaagcttgtttataacaacagcccatcattcaactggactttaaacttccgt
caacaagcgtacgatcgttgggttgcagaaggtaaagatgtatctgcttacgaccgtgct
aaattaatgagcgctgagtacgacaatactgaattagctgctgaagctgatgaaaaaatc
cgtactttccaagcagatgctgcgcgtgaagctggtgtgttccatcacttgatcacactt
cctacataccacactgctgctctttctactcatgaattagcacaaggttacttcggtgac
caaggtatgttagcttatgttgctggcgtacaacgtaaagaaatccgtggcggtatcgca
tgtgtgaaacaccaagcaatggctggttctgacatcggtgatgaccacaaagaaatcttc
gctggtgaaaatgcacttaaagctggtgacgatgctaaaaacacaatgaaccaattctca
gctcactaa

DBGET integrated database retrieval system