KEGG   Acinetobacter baumannii ATCC 17978: A1S_1601Help
Entry
A1S_1601          CDS       T00486                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:acb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A1S_1601
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    A1S_1601
   00630 Glyoxylate and dicarboxylate metabolism
    A1S_1601
Enzymes [BR:acb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     A1S_1601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
1864364..1866370
Genome map
AA seq 668 aa AA seqDB search
MAKRDELQAKIDEWHRNNKFELGAYKAFLTEIGYLLPEVEDFQITTENVDEEIALLAGPQ
LVVPVRNARYCLNAANARWGSLYDALYGFDVISEEGGAEKGKGYNPVRGAKVIEFAKNFL
NEIFPLAQGSHADATKYAIEQNKLVVTLKDGTKTGLAHEAQFVGFNGEEANPSEVVLLSN
GLHVIIEIDANSPIGQTDLAGVKDLTLEAAVTTIQDLEDSVAAVDAEEKVEGYRNWLGLM
KGTLQESIEKNGKTIVRALNKDREIKNLIGGTTKLHGRSLMLLRNVGHLMTNPAILVDGE
EIFEGIMDALVTPLLSIADIRSENENKNSRKGSMYIVKPKMHGPEEVAFAVELFERAEQA
LGLPAKSLKIGIMDEERRTSVNLKNCIAAAKDRTIFINTGFMDRTGDEIHTSMEAAPVVR
KEAVKTQKWIAAYENRNVAIGLKCGLQGKAQIGKGMWPKPDSMKDMLATKAAHPNAGASC
AWVPSPTGAVLHAMHYHQVNVKARQDQLKAEEMLSLDDLLTPPFATDTNWSAEEINNELE
NNCQGILGYVVRWVDLGVGCSKVPDINNVGLMEDRATLRISSQHVANWLRHGIVTREQVE
EVLKRMAKIVDEQNANDPLYKPMAANFETNIAFQAASDLIFKGCEQPSGYTEPLLHAARL
KLKGYTGD
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
ttggctaagcgtgatgaattacaagcaaaaattgatgaatggcaccgcaacaataaattt
gaattaggtgcttacaaagcatttttaactgaaattggttatttattaccagaagttgaa
gacttccaaattactactgaaaacgtagatgaagaaattgcattgttagcaggcccacaa
ttagtagtgcctgtacgtaatgcacgttattgtttaaatgcagcaaatgcgcgttggggt
tctttatatgatgcactttacggcttcgatgtaatttcagaagaaggtggtgcagaaaaa
ggaaaaggatataaccctgtacgtggtgcgaaagttattgagtttgctaaaaacttctta
aatgaaattttcccgcttgcgcaaggatcacatgctgatgcaactaaatatgcaatcgag
cagaataaactcgttgtgactttaaaagatggtactaaaactggcttagctcatgaagct
caatttgtgggcttcaatggtgaagaagcgaacccttcagaagttgttcttttgagtaat
ggcctacatgtcattattgaaattgatgcgaatagcccaattggccaaactgatttagcg
ggtgttaaagatctaacacttgaagctgcggttacaacaattcaggatcttgaagactct
gtagcagctgttgatgcagaagaaaaagttgaaggttatcgtaactggttaggtttgatg
aagggtactcttcaagaatctatcgaaaaaaatggtaaaacaattgttcgcgctttgaat
aaagaccgtgaaattaaaaatttgatcggtggcacaacaaaacttcatggtcgttcactt
atgttacttcgtaacgtaggtcatttaatgacgaatccagcgattttagttgatggtgaa
gaaattttcgaaggtattatggatgcgttggtaacgccattgttatcaattgctgacatc
cgtagtgaaaacgaaaataaaaactctcgtaaagggtctatgtatattgttaaaccaaaa
atgcatggtcctgaagaagttgcttttgctgttgagttatttgagcgtgctgagcaagcc
ctaggattaccagcgaagtctttaaaaatcggtattatggatgaagaacgccgtacatct
gtaaacctgaaaaactgtattgctgctgctaaagatcgcacaatctttattaacactggt
ttcatggaccgtactggtgatgaaatccatacttctatggaagctgctccagttgttcgt
aaagaagcagttaaaacacaaaaatggattgctgcttatgaaaaccgtaacgttgcaatt
ggtttgaaatgtggtttacaaggtaaagctcaaattggtaaaggcatgtggccaaaacca
gatagcatgaaagatatgttagcaactaaagctgctcatccaaatgctggtgcttcatgt
gcttgggttccatcaccaactggtgctgtacttcatgcgatgcattaccatcaagtaaat
gtaaaagcacgtcaagatcagttaaaagctgaagaaatgttgtcattagatgacttgtta
actcctccatttgcaactgatacaaactggtcagcagaagaaattaataacgaacttgaa
aataactgccaaggtattttaggttacgttgttcgttgggtggacttaggtgtaggttgt
tcaaaagttcctgatattaacaatgtgggcttaatggaagaccgtgcaacattacgtatt
tcttctcaacatgttgccaactggttacgtcacggtatcgtgactcgtgaacaagttgaa
gaagtgcttaaacgcatggcaaaaattgttgatgaacaaaatgcgaatgatccattgtat
aaaccaatggcagctaactttgaaactaatattgctttccaagcagcttcagatcttatc
tttaaaggttgtgaacagccttctggttatactgagccattactacatgcggctcgttta
aaattaaaaggttatacaggtgactaa

DBGET integrated database retrieval system