KEGG   Acinetobacter baumannii ATCC 17978: A1S_1601Help
Entry
A1S_1601          CDS       T00486                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:acb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A1S_1601
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    A1S_1601
   00630 Glyoxylate and dicarboxylate metabolism
    A1S_1601
Enzymes [BR:acb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     A1S_1601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1864364..1866370
Genome map
AA seq 668 aa AA seqDB search
MAKRDELQAKIDEWHRNNKFELGAYKAFLTEIGYLLPEVEDFQITTENVDEEIALLAGPQ
LVVPVRNARYCLNAANARWGSLYDALYGFDVISEEGGAEKGKGYNPVRGAKVIEFAKNFL
NEIFPLAQGSHADATKYAIEQNKLVVTLKDGTKTGLAHEAQFVGFNGEEANPSEVVLLSN
GLHVIIEIDANSPIGQTDLAGVKDLTLEAAVTTIQDLEDSVAAVDAEEKVEGYRNWLGLM
KGTLQESIEKNGKTIVRALNKDREIKNLIGGTTKLHGRSLMLLRNVGHLMTNPAILVDGE
EIFEGIMDALVTPLLSIADIRSENENKNSRKGSMYIVKPKMHGPEEVAFAVELFERAEQA
LGLPAKSLKIGIMDEERRTSVNLKNCIAAAKDRTIFINTGFMDRTGDEIHTSMEAAPVVR
KEAVKTQKWIAAYENRNVAIGLKCGLQGKAQIGKGMWPKPDSMKDMLATKAAHPNAGASC
AWVPSPTGAVLHAMHYHQVNVKARQDQLKAEEMLSLDDLLTPPFATDTNWSAEEINNELE
NNCQGILGYVVRWVDLGVGCSKVPDINNVGLMEDRATLRISSQHVANWLRHGIVTREQVE
EVLKRMAKIVDEQNANDPLYKPMAANFETNIAFQAASDLIFKGCEQPSGYTEPLLHAARL
KLKGYTGD
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
ttggctaagcgtgatgaattacaagcaaaaattgatgaatggcaccgcaacaataaattt
gaattaggtgcttacaaagcatttttaactgaaattggttatttattaccagaagttgaa
gacttccaaattactactgaaaacgtagatgaagaaattgcattgttagcaggcccacaa
ttagtagtgcctgtacgtaatgcacgttattgtttaaatgcagcaaatgcgcgttggggt
tctttatatgatgcactttacggcttcgatgtaatttcagaagaaggtggtgcagaaaaa
ggaaaaggatataaccctgtacgtggtgcgaaagttattgagtttgctaaaaacttctta
aatgaaattttcccgcttgcgcaaggatcacatgctgatgcaactaaatatgcaatcgag
cagaataaactcgttgtgactttaaaagatggtactaaaactggcttagctcatgaagct
caatttgtgggcttcaatggtgaagaagcgaacccttcagaagttgttcttttgagtaat
ggcctacatgtcattattgaaattgatgcgaatagcccaattggccaaactgatttagcg
ggtgttaaagatctaacacttgaagctgcggttacaacaattcaggatcttgaagactct
gtagcagctgttgatgcagaagaaaaagttgaaggttatcgtaactggttaggtttgatg
aagggtactcttcaagaatctatcgaaaaaaatggtaaaacaattgttcgcgctttgaat
aaagaccgtgaaattaaaaatttgatcggtggcacaacaaaacttcatggtcgttcactt
atgttacttcgtaacgtaggtcatttaatgacgaatccagcgattttagttgatggtgaa
gaaattttcgaaggtattatggatgcgttggtaacgccattgttatcaattgctgacatc
cgtagtgaaaacgaaaataaaaactctcgtaaagggtctatgtatattgttaaaccaaaa
atgcatggtcctgaagaagttgcttttgctgttgagttatttgagcgtgctgagcaagcc
ctaggattaccagcgaagtctttaaaaatcggtattatggatgaagaacgccgtacatct
gtaaacctgaaaaactgtattgctgctgctaaagatcgcacaatctttattaacactggt
ttcatggaccgtactggtgatgaaatccatacttctatggaagctgctccagttgttcgt
aaagaagcagttaaaacacaaaaatggattgctgcttatgaaaaccgtaacgttgcaatt
ggtttgaaatgtggtttacaaggtaaagctcaaattggtaaaggcatgtggccaaaacca
gatagcatgaaagatatgttagcaactaaagctgctcatccaaatgctggtgcttcatgt
gcttgggttccatcaccaactggtgctgtacttcatgcgatgcattaccatcaagtaaat
gtaaaagcacgtcaagatcagttaaaagctgaagaaatgttgtcattagatgacttgtta
actcctccatttgcaactgatacaaactggtcagcagaagaaattaataacgaacttgaa
aataactgccaaggtattttaggttacgttgttcgttgggtggacttaggtgtaggttgt
tcaaaagttcctgatattaacaatgtgggcttaatggaagaccgtgcaacattacgtatt
tcttctcaacatgttgccaactggttacgtcacggtatcgtgactcgtgaacaagttgaa
gaagtgcttaaacgcatggcaaaaattgttgatgaacaaaatgcgaatgatccattgtat
aaaccaatggcagctaactttgaaactaatattgctttccaagcagcttcagatcttatc
tttaaaggttgtgaacagccttctggttatactgagccattactacatgcggctcgttta
aaattaaaaggttatacaggtgactaa

DBGET integrated database retrieval system