KEGG   Acinetobacter baumannii ATCC 17978: A1S_1615Help
Entry
A1S_1615          CDS       T00486                                 

Definition
PAPS (adenosine 3'-phosphate 5'-phosphosulfate) x
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:acb00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    A1S_1615
Enzymes [BR:acb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     A1S_1615
Transfer RNA biogenesis [BR:acb03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    A1S_1615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1884363..1884944
Genome map
AA seq 193 aa AA seqDB search
MLDPLDGTKEFIHERDEFTINLSLIEGRETIFSVIVVPCEQVVYLGYLKDLPFKYSFSQQ
QWYQYQKTPYSTQAPVQIGLSHSSKNPKYQKFIEPIEKIRTVIRREAGSAYKFCMMLEGE
IDIYPRFHPTSEWDTSSGQGLLESIGGGLLTLTGKPFEYNQRDTVLNEGFIAFRDQESKK
IAFEALAQSGVLD
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgctagatccacttgatggtacaaaagagtttatacatgagcgagatgagttcacgata
aacttgagtttgattgaagggcgtgaaacgattttttcggtgattgttgtgccatgtgag
caagttgtttatttaggttatttaaaagatttaccttttaaatatagctttagccaacaa
caatggtatcaatatcaaaaaacaccttattcaacacaagcacctgtacaaattggttta
agtcatagtagtaaaaatccaaaatatcagaaattcattgaacctattgaaaagattcgt
accgtaattcgacgtgaagcaggtagcgcttataagttttgtatgatgttagaaggcgag
atcgatatttatcctagatttcatccgacatcagaatgggataccagctcaggtcaagga
ttattagaaagtataggtggaggtttactcactctaacaggtaaaccctttgaatataac
cagcgtgataccgtattaaatgagggctttatcgcatttcgtgatcaggaaagcaaaaaa
atagcatttgaagctttagctcaatcaggtgttttggattga

DBGET integrated database retrieval system