KEGG   Acinetobacter baumannii ATCC 17978: A1S_1685Help
Entry
A1S_1685          CDS       T00486                                 

Definition
(GenBank) recombination protein gap repair
  KO
K06187  
recombination protein RecR
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:acb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    A1S_1685
DNA repair and recombination proteins [BR:acb03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     A1S_1685
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      A1S_1685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1960993..1961589
Genome map
AA seq 198 aa AA seqDB search
MFSDRFEQLVQALRILPSVGPKSAQRMALHLLMKNREGAFALAHALHEASSYIHECSVCH
SLTEHEICDICASTERDDQLLCVVESPADVMAIEQSGSFRGKYHVLGGHLSPLDGIGPEE
IGIPYLIQRLSQGTIEEVILATNATVEGQATAHYLVEATKHLPIHMTRIAQGVPQGGELE
YVDSHTLSQAVHNRMRMK
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgtttagtgatagatttgaacaactcgttcaagctttacgtattttgcctagcgttgga
ccgaagtcggcccaacgtatggctttacatcttttgatgaaaaatcgtgaaggtgcattt
gctttagcacatgctctacatgaagcatcaagttatattcatgaatgtagtgtttgccac
tctttaacagagcacgaaatttgtgatatttgcgcttcaacagaaagagatgaccaattg
ctttgtgtagttgagtctccggcagatgttatggcaatcgagcaaagtggtagttttcgt
ggcaaataccatgtgttgggtgggcacctttctccattagatggaatcgggccagaagaa
ataggtattccttatctaatccaacggttaagccaaggtacgatcgaagaagtcattttg
gcaactaatgctactgtggaaggtcaggcgacagcgcattatttggttgaagcgacgaag
catttacctattcatatgacacgtattgctcaaggcgtaccacaaggtggcgagcttgaa
tatgtggatagtcataccttaagtcaggctgttcataaccgtatgcgtatgaaataa

DBGET integrated database retrieval system