KEGG   Acinetobacter baumannii ATCC 17978: A1S_1685Help
Entry
A1S_1685          CDS       T00486                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:acb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    A1S_1685 (recR)
DNA repair and recombination proteins [BR:acb03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      A1S_1685 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1961071..1961589
Genome map
AA seq 172 aa AA seqDB search
MALHLLMKNREGAFALAHALHEASSYIHECSVCHSLTEHEICDICASTERDDQLLCVVES
PADVMAIEQSGSFRGKYHVLGGHLSPLDGIGPEEIGIPYLIQRLSQGTIEEVILATNATV
EGQATAHYLVEATKHLPIHMTRIAQGVPQGGELEYVDSHTLSQAVHNRMRMK
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggctttacatcttttgatgaaaaatcgtgaaggtgcatttgctttagcacatgctcta
catgaagcatcaagttatattcatgaatgtagtgtttgccactctttaacagagcacgaa
atttgtgatatttgcgcttcaacagaaagagatgaccaattgctttgtgtagttgagtct
ccggcagatgttatggcaatcgagcaaagtggtagttttcgtggcaaataccatgtgttg
ggtgggcacctttctccattagatggaatcgggccagaagaaataggtattccttatcta
atccaacggttaagccaaggtacgatcgaagaagtcattttggcaactaatgctactgtg
gaaggtcaggcgacagcgcattatttggttgaagcgacgaagcatttacctattcatatg
acacgtattgctcaaggcgtaccacaaggtggcgagcttgaatatgtggatagtcatacc
ttaagtcaggctgttcataaccgtatgcgtatgaaataa

DBGET integrated database retrieval system