KEGG   Acinetobacter baumannii ATCC 17978: A1S_1692Help
Entry
A1S_1692          CDS       T00486                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:acb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    A1S_1692
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A1S_1692
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    A1S_1692
Enzymes [BR:acb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     A1S_1692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1967743..1968948
Genome map
AA seq 401 aa AA seqDB search
MQHQINGIALPNEQGFFGEYGGQFIPPHLKEAMDEINVAYEEIRHTPEFQNELADLFANY
VGRPSPLFYAKRLSEQLGGAQIYLKREDLNHTGAHKINHCLGEALLAKYMGKKKIIAETG
AGQHGVALATACALVGIPCEIHMGQVDIEKEHPNVVKMKILGAHLVSVTRGTATLKDAVD
SAFEEYLKDPKNFIYAIGSVVGPHPFPKMVRDFQSIIGKEIKEQTHQRFGKNPDYIVACV
GGGSNAIGAFTAFLNDSDVKLVGVEPAGHGLDTNMHSATLTLGKPSQIHGMACYVLENEA
GEPLPVHSIASGLDYPGVGPQHSFLKDLGRVEYSTATDQECLDAFMTLSRVEGIVPALES
SHAVAWAIREAPKLPKETMIVVNLSGRGDKDSDYVAEKLKL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgcaacatcaaattaatggtattgctttaccgaatgaacaaggattttttggtgaatat
ggagggcaatttattcctccacatttaaaagaagcaatggatgaaattaatgttgcttat
gaagaaattcgccatacaccagaatttcaaaatgaattagcagacctctttgcaaattat
gtcggccgtccaagtcctttattttatgcaaaacgcctttcagaacagttaggtggcgcg
caaatttatttaaaacgtgaagacttaaatcataccggtgcccataaaattaatcactgt
ttaggtgaggctttacttgctaagtatatgggcaaaaagaaaatcattgccgaaacgggt
gcgggtcagcatggggtggctttagcaacggcttgtgctttagttggtattccatgtgag
atccacatgggtcaagttgatattgaaaaagaacatccaaatgtggtcaaaatgaaaatt
ttgggcgctcatttggtgtcagtaactcgcggtacagcaaccttaaaagatgcggttgat
agcgcgtttgaagaatatttaaaagatcctaaaaattttatttatgcgattggttctgtg
gttggaccccatccatttcctaaaatggttcgagattttcaatcgattattggtaaggaa
attaaagagcagacgcatcaaagatttggaaaaaatccggattatattgtcgcatgtgtc
ggtggcggttcaaatgcaatcggtgcatttacagcttttttaaatgattcagatgtgaaa
cttgtaggagttgaacctgctgggcatgggctagatacaaatatgcattcggcaacccta
acattaggtaaaccaagccaaattcatggtatggcatgttatgttcttgaaaatgaggct
ggtgaacctttacctgtgcattctatcgcttcaggtttggactatcctggtgttgggcca
caacatagtttcttaaaagatttaggccgtgtggaatatagcactgcaactgaccaagaa
tgtttagacgcgtttatgaccttatcacgagttgaaggtattgttcctgcgcttgaaagc
tcacatgctgtcgcatgggcaatacgtgaagcgccaaaactgccgaaagaaaccatgatc
gtggtgaatctatcgggtcgtggcgataaagattctgattatgtggcagaaaaacttaag
ctttaa

DBGET integrated database retrieval system