KEGG   Acinetobacter baumannii ATCC 17978: A1S_1701Help
Entry
A1S_1701          CDS       T00486                                 

Definition
dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:acb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A1S_1701
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A1S_1701
   00020 Citrate cycle (TCA cycle)
    A1S_1701
   00620 Pyruvate metabolism
    A1S_1701
Enzymes [BR:acb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     A1S_1701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1978428..1979918
Genome map
AA seq 496 aa AA seqDB search
MEEGTIAQWLIKEGDSFNKGDEICEIETTKIVNVLEAPFAGTLRKILAKDGDTLPVGGLI
AVCADSEVSDAEIEKFIASLGGSAAQAPEAPSEQSKAETSAPVAEKTEQPQTVAASASAP
AKVAKEDYAVPESLQGYQTSNELFATPHALKLAEKHNVNLAKVTGSGREGRISVQDIQKA
VQAAGGQWPDVKQQTQAKVVKSTADDSQVLATPVARRLAKQWGINLNDCRVSGTRGRVCK
EDVEAVYYRNNPTSVNEQPVQCAAQPQSTVTTVAMNGMRKAIASRLQAAKRNAPHFRLVV
DLNVEALQKLRKQINETVPQVKLSINDMLIKAAAAALIKVPEVNVQFDEATQSILQFSQA
DISVAVAIPNGLITPIVKAANQKSLAQISDDMRDLATRAKTGKLQPDEFQGGSFSISNLG
MLGIKQFDAIINPPQGAIMALGASESRAVVENGNVVVREIVTATLSCDHRVIDGAVGAKF
LASFKQFVENPALILV
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaggcacgatcgcccaatggttgattaaagagggtgatagctttaataaaggc
gatgaaatttgtgaaattgaaaccacaaaaatcgtcaatgtgttagaagcgccttttgct
ggaacgctccgtaaaattttagcgaaagatggtgatactttacctgttggtggtcttatt
gccgtatgtgctgatagtgaagtttctgatgcagaaattgaaaagtttattgcatcacta
ggtggttcagcagctcaagccccggaagcaccttcggagcaaagtaaagcggaaacatct
gcacctgttgctgaaaaaacagaacaaccacagactgtagcagctagtgcttcagctcct
gcaaaggtagcgaaagaggactacgctgtaccagagtcattacaaggctatcaaacatct
aatgagttgtttgcaacaccgcatgccttgaagcttgcagaaaaacacaatgtaaacttg
gcaaaagtcacaggttctggtcgtgaaggacgtattagtgttcaagacatccagaaagct
gtacaagctgctggtggtcaatggcctgatgttaagcagcaaactcaagctaaagtggtt
aaatctacggccgatgatagccaagttttagcgacgcctgtagcacgtcgtttagcaaag
cagtggggcattaacctaaatgactgtcgtgtttcaggtactcgtggccgtgtctgtaaa
gaagatgttgaggcagtttactatcgtaataacccaacatcggtaaatgaacaacctgta
caatgtgcagcccaaccacaatcaaccgttacgacggtggcgatgaatgggatgcgtaaa
gcgattgcttcacggttacaggctgcaaaacgtaacgcaccgcatttccgtttagtggtc
gatctcaacgtagaagctttgcaaaaactacgtaagcagattaatgagactgttccacaa
gtcaaactttctattaatgacatgctaattaaggcagctgccgccgcactgattaaagta
cctgaggtgaatgttcaatttgatgaggcgacccaatcaattttacagttctctcaagcg
gatatttcggtggccgtagcgattccaaacggtttaattacacccattgtaaaagcagca
aatcagaagtctttagcacaaatttccgatgacatgcgtgatttggcaacgcgtgctaag
actggcaagttacaacctgacgagtttcagggaggcagctttagcatttcaaatttagga
atgttaggcattaaacagttcgatgccattatcaacccaccgcaaggtgcaattatggca
ttaggtgcttcggaatctcgcgctgttgttgaaaatggcaatgtagtggttcgtgagatt
gtcacagcgacgttgtcatgcgatcaccgagttattgatggcgcagttggggcgaaattc
ttggccagctttaagcagtttgttgaaaaccctgctttaattttggtgtag

DBGET integrated database retrieval system