KEGG   Acinetobacter baumannii ATCC 17978: A1S_1737Help
Entry
A1S_1737          CDS       T00486                                 

Definition
(GenBank) 3-hydroxybutyrate dehydrogenase
  KO
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acb00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    A1S_1737
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    A1S_1737
Enzymes [BR:acb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     A1S_1737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2021993..2022778
Genome map
AA seq 261 aa AA seqDB search
MTKLLDGKVAFITGSASGIGLEIAKKFAQEGAKVVISDMNAEKCQETANSLKEQGFDALS
APCDVTDEDAYKQAIELTQKTFGTVDILINNAGFQHVAPIEEFPTAVFQKLVQVMLTGAF
IGIKHVLPIMKAQKYGRIINMASINGLIGFAGKAGYNSAKHGVIGLTKVAALECARDGIT
VNALCPGYVDTPLVRGQIADLAKTRNVSLDSALEDVILAMVPQKRLLSVEEIADYAIFLA
SSKAGGVTGQAVVMDGGYTAQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaacttttagacggtaaggtcgcttttattacaggttctgcaagtggtatcggt
ctggagattgctaagaaatttgctcaagaaggtgccaaagttgttatttctgatatgaat
gccgaaaagtgccaagaaacggcaaactcacttaaagagcaaggttttgatgcattatct
gcaccatgcgatgtaactgatgaagatgcttataaacaagccattgagctcactcaaaag
acctttggtacggttgatatcttaattaataatgctggttttcaacatgttgcacctatt
gaagagtttccaacggctgtttttcaaaagttagttcaagtcatgttaactggggcattt
attggtattaaacatgttcttccaattatgaaagctcaaaaatatggccgtatcattaat
atggcctctattaatggcttgattggtttcgctggaaaggctggttataatagtgctaaa
catggcgtaattggcctaacaaaagttgcggcattagaatgtgcacgcgatggtattacg
gtaaatgcactatgtccgggttatgtagatacaccattggtccgtgggcaaattgctgat
ttggctaaaacccgtaatgtgagtttagacagcgcacttgaagatgtaattttggcaatg
gttcctcaaaagcgtttgctctctgttgaagaaattgctgactatgcgattttccttgcg
agtagcaaagcaggtggggtaacaggccaggctgttgttatggatggtggttacaccgct
caataa

DBGET integrated database retrieval system