KEGG   Acinetobacter baumannii ATCC 17978: A1S_1919Help
Entry
A1S_1919          CDS       T00486                                 

Definition
phospholipase A1 precursor (PldA)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acb00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    A1S_1919
   00565 Ether lipid metabolism
    A1S_1919
   00590 Arachidonic acid metabolism
    A1S_1919
   00591 Linoleic acid metabolism
    A1S_1919
   00592 alpha-Linolenic acid metabolism
    A1S_1919
Enzymes [BR:acb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     A1S_1919
    3.1.1.32  phospholipase A1
     A1S_1919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2222938..2224014)
Genome map
AA seq 358 aa AA seqDB search
MAYADTLAPVKPASVDACVALASNADRLACYDAVFKPSALPVVQAAVVPEPVKKIDKPVV
QPETFKEKVVDKVSNIKVIGKAPTLEPTTSLLDQRWELSEKSKLGVWNIRAYQPVYLLPV
FWTSDKNEFPSSPNPNNTVTEAQNLKSTESKFQISLKTKAWENIFGNNGDLWVGYTQSSR
WQTFNAEESRPFRETNYEPEASLMFRTNYELLGLDGRLLGVTLNHQSNGRSDPLSRSWNR
VIFNVGLERGNFALMLRPWIRLEEDSKDDNNPDMEDYIGRGDLTAFYKWKQNDFSLMLRH
SLKGGDDSHGAVQFDWAFPISGKLRGHFQLFNGYGESLIDYNHRATYAGLGVSLMNWY
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
gtggcatatgccgacaccttagcccctgtaaaacctgcgagtgtagatgcatgtgttgcc
cttgcttcgaatgctgatcgcctagcttgttatgatgctgtgtttaaaccatcggcctta
ccagtagttcaagccgcagtagtaccagagcctgttaaaaaaattgataaacctgttgtt
caacctgaaacatttaaagaaaaggttgtagataaggtaagtaatatcaaagtaattggt
aaggcacctacacttgaacctactacgtctttactagatcaacgttgggagttgtctgaa
aaaagcaaactgggtgtttggaatattcgtgcttatcaacctgtttacttgctaccagtt
ttctggacgagcgataaaaatgagtttccaagcagtcccaacccaaataatacggtgaca
gaggcccaaaaccttaaatcaactgaaagtaaatttcagatttctttgaaaacgaaagct
tgggaaaatatttttggcaacaatggtgacttgtgggtaggttatacccaatcttcacgt
tggcagacctttaatgctgaagagtctcgtccattccgtgaaacgaactatgagccagaa
gcaagtttaatgtttagaacaaactatgagttgcttggcttagatggtcggttgcttggg
gtaactttaaatcaccagtcaaatggacgttcagatcctttatctcgtagttggaaccgt
gtcatctttaatgtgggtttagaacgcggtaactttgctttaatgcttcgtccatggata
cgccttgaagaagacagcaaagatgataacaatccagatatggaagattacatcggtcgt
ggtgatttaactgctttttataaatggaagcaaaatgacttctcattaatgctacgtcac
tctttaaaaggtggtgatgattctcatggtgctgttcagtttgactgggctttcccgatt
agtggcaagctgcgcggacacttccaattatttaatggttatggtgaaagcttaattgac
tataaccatcgtgcaacttatgccggcttgggtgtttcactcatgaactggtactaa

DBGET integrated database retrieval system