KEGG   Acinetobacter baumannii ATCC 17978: A1S_2273Help
Entry
A1S_2273          CDS       T00486                                 

Definition
3'-terminal phosphate cyclase
Orthology
K01974  
RNA 3'-terminal phosphate cyclase (ATP) [EC:6.5.1.4]
Organism
acb  Acinetobacter baumannii ATCC 17978
Brite
Enzymes [BR:acb01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.4  RNA 3'-terminal-phosphate cyclase (ATP)
     A1S_2273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2633247..2634158
Genome map
AA seq 303 aa AA seqDB search
MITGQAFELINIRAGRKKPGLMRQHLVCVQASQQISQAYVEGAELHSQRLYFAPQHVQSG
KYQFQIGSAGSTTLVLQTLLPVLLLQNEATELTISGGTHNPLAPTADFIEHCFLPALTKI
GINVDFRLNKAGFFPIGAGEIQVTIQPWQHRNSLKLLDRGALQCNEAFAAVLNISEEAQI
AQRELITLSKKLNLSSQQQFHLNGISQGNTVYVKVTHQYHTQLFTALGEMRKSAEQIADH
LAKDVNLYLSSQAVVDEYLADQLLLPLALGQGGEFTAQCISEHTRTQAAMLKNLLIVKSN
LSS
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgattacaggtcaggcatttgaattaattaatatacgtgcaggacgtaaaaaaccaggg
ttaatgcgtcaacatttggtttgtgtacaagcatctcaacaaattagccaagcttatgta
gagggtgctgaattacatagccaacgtttatatttcgcacctcagcatgttcaaagtggt
aaatatcaatttcaaatcggttcagcgggtagtacaacactggttttacaaacgcttcta
cctgttttgttattacaaaatgaagctaccgaactcaccatttcagggggtacacataac
ccacttgcaccaacagcagattttattgaacactgctttttacctgctctaacaaagatt
ggaattaacgtcgattttagattaaataaagctggcttttttccaattggtgcgggtgaa
attcaagttaccattcagccatggcaacatcgaaacagcttaaagttattagaccgtggt
gctttgcaatgcaatgaagcttttgcagcagtattaaatatttcagaagaagcgcagata
gcacaacgtgaattaatcacattaagtaaaaaactaaacttaagctctcagcaacaattt
catttaaatggaattagccaaggcaatacagtctatgtgaaagttactcatcaatatcac
actcaactgtttacagctttaggtgagatgcgcaaaagtgcagagcaaatagctgatcat
ttagcaaaagatgtaaatttatatttatcttcgcaggctgttgtagatgagtatttggca
gatcaattgcttctgcctttagctttaggtcaaggtggtgaattcaccgcacaatgtatt
agcgaacatactcgtactcaagcagccatgttgaaaaatttattgattgtgaaatcgaat
ttgtcgagttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system