KEGG   Acinetobacter baumannii ATCC 17978: A1S_2360Help
Entry
A1S_2360          CDS       T00486                                 

Gene name
trpC
Definition
Indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:acb01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:acb00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2733560..2734243
Genome map
AA seq 227 aa AA seqDB search
MRGFANALQHKRPGVIAEIKKASPSKGIIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQ
GADENIAIARNHCALPALRKDFLVDPYNVVEARALHADCILLIVACLSDQQLEEMSKTAF
EHQLDVLVEVHDEEELERALKLSEQCLLGVNNRNLKTFDVDLNTTIRLKKLLPASRLLIT
ESGIATPDDVRMMQEHDIHSFLVGESFMKQPRPDQAFTALFGQPQTV
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtggctttgcaaatgctttacaacataaacgtccgggcgtgattgctgaaattaaa
aaagcatctccatcaaaaggaatcattcgcgcagactttaatcctgccgaaattgctcag
caatatgaacaagctggagcagcatgtttatcggtattgaccgatgttgatttctttcag
ggtgcagatgaaaatattgcgattgcccgtaatcattgtgccctacctgctttacgtaaa
gactttttggtcgacccatacaatgtagttgaagcacgtgctttgcatgctgactgtatt
ttattaattgttgcttgtttgtctgaccagcaactcgaagaaatgtctaaaactgcgttt
gagcatcaacttgatgtattggttgaagttcatgacgaagaagagttggagcgtgcctta
aagctttctgagcaatgtttattaggcgtgaataaccgtaatttaaaaacctttgatgta
gatttaaatactactattcggttgaaaaaattacttccggcctcacgtttattgatcact
gaaagtggtattgcgacaccagatgatgtacgtatgatgcaagagcatgatattcacagt
ttcttggttggcgaaagttttatgaaacaaccacgtccagatcaagcttttactgccctt
tttggacaacctcaaacggtttaa

DBGET integrated database retrieval system