KEGG   Acinetobacter baumannii ATCC 17978: A1S_2360Help
Entry
A1S_2360          CDS       T00486                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase (IGPS)
  KO
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:acb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    A1S_2360
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    A1S_2360
Enzymes [BR:acb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     A1S_2360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2733437..2734243
Genome map
AA seq 268 aa AA seqDB search
MINIQNTILGKIVDRKHEELAARLKQRNLQDVEELAKAATPVRGFANALQHKRPGVIAEI
KKASPSKGIIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARNHCALPALR
KDFLVDPYNVVEARALHADCILLIVACLSDQQLEEMSKTAFEHQLDVLVEVHDEEELERA
LKLSEQCLLGVNNRNLKTFDVDLNTTIRLKKLLPASRLLITESGIATPDDVRMMQEHDIH
SFLVGESFMKQPRPDQAFTALFGQPQTV
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgattaatattcaaaataccattttaggtaaaattgttgaccgtaaacatgaggaactt
gctgcgcgtttaaaacaacgtaatttgcaagatgtagaagagcttgcaaaagcagcgact
ccggtgcgtggctttgcaaatgctttacaacataaacgtccgggcgtgattgctgaaatt
aaaaaagcatctccatcaaaaggaatcattcgcgcagactttaatcctgccgaaattgct
cagcaatatgaacaagctggagcagcatgtttatcggtattgaccgatgttgatttcttt
cagggtgcagatgaaaatattgcgattgcccgtaatcattgtgccctacctgctttacgt
aaagactttttggtcgacccatacaatgtagttgaagcacgtgctttgcatgctgactgt
attttattaattgttgcttgtttgtctgaccagcaactcgaagaaatgtctaaaactgcg
tttgagcatcaacttgatgtattggttgaagttcatgacgaagaagagttggagcgtgcc
ttaaagctttctgagcaatgtttattaggcgtgaataaccgtaatttaaaaacctttgat
gtagatttaaatactactattcggttgaaaaaattacttccggcctcacgtttattgatc
actgaaagtggtattgcgacaccagatgatgtacgtatgatgcaagagcatgatattcac
agtttcttggttggcgaaagttttatgaaacaaccacgtccagatcaagcttttactgcc
ctttttggacaacctcaaacggtttaa

DBGET integrated database retrieval system