KEGG   Acinetobacter baumannii ATCC 17978: A1S_2366Help
Entry
A1S_2366          CDS       T00486                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:acb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    A1S_2366
Enzymes [BR:acb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     A1S_2366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2740261..2740635
Genome map
AA seq 124 aa AA seqDB search
MVLVKNIEFYSLCEHHLLPFYGRVHVAYLPEGKVLGLSKFARITEMFARRLQIQENLTQQ
IAEAVAEVTGARGVAVVIDSAHMCMMMRGVGKQESTTRTVSFVGDFKTDKEARREFLSAV
PESY
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggtattggtgaagaatattgaattttattcgctctgcgaacatcatcttctcccattc
tatggccgtgttcatgttgcctatttaccagaaggcaaagttcttggcttatctaaattt
gcacgtattaccgagatgtttgctcgtcgtttgcaaattcaggaaaacctgactcagcaa
atcgctgaagctgttgcagaagtcactggtgctcgcggtgtcgctgtagtcatcgattca
gcacatatgtgtatgatgatgcgtggtgtaggtaaacaagaatctaccacccgtacagtt
tcatttgtcggagattttaaaaccgataaagaagcgcgccgtgaattcttaagtgcagta
ccagaaagctactaa

DBGET integrated database retrieval system