KEGG   Acinetobacter baumannii ATCC 17978: A1S_2399Help
Entry
A1S_2399          CDS       T00486                                 

Definition
(GenBank) dihydroflavonol 4-reductase putative
  KO
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
acb  Acinetobacter baumannii ATCC 17978
Brite
Enzymes [BR:acb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     A1S_2399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2784126..2785025
Genome map
AA seq 299 aa AA seqDB search
MKALVTGSAGFIGSHIVRTLLNENYEVRVLHLPQEKLTNLEGLDVELIAGDITDPAKMDE
AVSGCDLVFHTAAIYALWLPKPELMRKVNVEGTRTVLNAAKKAGVKRVVYTSTGACFAGQ
PKGIQATETSPFALGATGDAYVLTKFEAHQVALQFAAGGLDIVIVCPTGPIGPQDIAPTP
TGKLLLTIATMPALAVPGAINNMVDVRDVAKGHVLAAQKGKTGETYILGNRDLDGVAMAK
TVHQLLGIWRPVMTIPSVVEGVSSQLAGHAALWVTEHITHKAPLVDPFGSQNRSARHLI
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctctggttactggtagtgctggttttattggttcccacattgtacgtacttta
ctcaatgagaattatgaagtacgtgtactgcatttacctcaagaaaaattaaccaattta
gaagggttagatgttgagttaattgcgggcgacattaccgacccagcaaaaatggatgaa
gcagtatctggttgtgatttggtttttcatactgccgcaatttatgccttatggcttcca
aagcctgagcttatgcgtaaagtcaatgttgaaggaacacgaaccgtactcaatgctgca
aaaaaggctggtgttaaacgtgttgtttacaccagtacaggcgcatgttttgcaggtcaa
ccaaaaggcattcaggccaccgaaacaagtccatttgctttaggcgcgactggagatgca
tacgttttaacaaaatttgaagcacatcaggttgccttacagtttgccgcgggcggctta
gatattgtgattgtctgcccgacaggtccaattggccctcaagatattgccccaaccccg
acaggaaaacttttactcaccatcgctaccatgcctgcccttgctgtaccgggtgcaatt
aacaacatggttgatgtacgcgatgtagcaaaaggccatgtcttggccgcgcaaaaaggt
aaaactggcgaaacctatattttaggtaatcgagatcttgatggcgtagcgatggcaaaa
acggtccatcagctcttaggtatctggcgtccagtaatgaccattccaagtgtagttgaa
ggtgtctcatctcaacttgcgggccatgcagctttgtgggtaacagagcatattactcat
aaagctccccttgttgaccccttcggcagccaaaatcggtcagctcggcacctcatttaa

DBGET integrated database retrieval system