KEGG   Acinetobacter baumannii ATCC 17978: A1S_2587Help
Entry
A1S_2587          CDS       T00486                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:acb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    A1S_2587 (ruvA)
Enzymes [BR:acb01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     A1S_2587 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2996448..2996978
Genome map
AA seq 176 aa AA seqDB search
MGYEIDTPLSTFCQLQKGQKVTLWTHLVVREDAQQLYGFSDAQEKTIFRTLLKVNGVGPK
MALGILSTLSVELLVHTIEHDDVNTLVKVPGVGKKTAERLMIELRDRFKTLAQGTSSAAA
LPQIQFVSNSPVAEAEAALQSLGYKPLEAQKAVAAVKADYTESADIIRAALKSMMK
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
gtgggctatgaaattgatacaccactttcaacattttgccaattacaaaaaggccagaaa
gttacgctatggacgcatttggtcgtccgtgaagatgctcagcagctttatggttttagt
gatgctcaagagaaaactattttccgtaccttactaaaagtaaatggtgtgggcccgaaa
atggcattaggtattctttctacgttaagtgttgaattgctggtacacacaattgaacat
gacgatgtgaatactttggttaaagttccgggggtaggcaaaaaaacagctgaacgttta
atgattgaacttcgtgaccgttttaaaactttggcacaaggaacttctagcgctgcggcc
ctgcctcagattcaatttgtttcgaactcacctgttgcagaagcagaagcagcattacag
tcactaggttataaaccactagaagcacaaaaagctgttgcggcggttaaagccgattac
actgaatcagccgatattattcgtgctgcacttaaatcaatgatgaagtaa

DBGET integrated database retrieval system