KEGG   Acinetobacter baumannii ATCC 17978: A1S_2587Help
Entry
A1S_2587          CDS       T00486                                 

Definition
(GenBank) holliday junction helicase subunit A
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:acb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    A1S_2587
Enzymes [BR:acb01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     A1S_2587
DNA repair and recombination proteins [BR:acb03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     A1S_2587
    RecFOR pathway proteins
     A1S_2587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2996379..2996978
Genome map
AA seq 199 aa AA seqDB search
MIGCLIGEVFALEAPTVLLNVNGVGYEIDTPLSTFCQLQKGQKVTLWTHLVVREDAQQLY
GFSDAQEKTIFRTLLKVNGVGPKMALGILSTLSVELLVHTIEHDDVNTLVKVPGVGKKTA
ERLMIELRDRFKTLAQGTSSAAALPQIQFVSNSPVAEAEAALQSLGYKPLEAQKAVAAVK
ADYTESADIIRAALKSMMK
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgatcggatgtttaattggcgaagtgtttgccctagaagccccaactgtcttactgaat
gtaaatggtgtgggctatgaaattgatacaccactttcaacattttgccaattacaaaaa
ggccagaaagttacgctatggacgcatttggtcgtccgtgaagatgctcagcagctttat
ggttttagtgatgctcaagagaaaactattttccgtaccttactaaaagtaaatggtgtg
ggcccgaaaatggcattaggtattctttctacgttaagtgttgaattgctggtacacaca
attgaacatgacgatgtgaatactttggttaaagttccgggggtaggcaaaaaaacagct
gaacgtttaatgattgaacttcgtgaccgttttaaaactttggcacaaggaacttctagc
gctgcggccctgcctcagattcaatttgtttcgaactcacctgttgcagaagcagaagca
gcattacagtcactaggttataaaccactagaagcacaaaaagctgttgcggcggttaaa
gccgattacactgaatcagccgatattattcgtgctgcacttaaatcaatgatgaagtaa

DBGET integrated database retrieval system