KEGG   Acinetobacter baumannii ATCC 17978: A1S_2670Help
Entry
A1S_2670          CDS       T00486                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:acb00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3096132..3097484)
Genome map
AA seq 450 aa AA seqDB search
MEIWATQSAVWVEALAQAGIKSEQVAAIGITNQRETTIVWDKKTGRPIYNAIVWQSRQTT
EICNQLYKAGWQEYIRKTTGLVIDPYFSATKIKWILDHVEGSRERAERGELLFGTVDTWL
IWKLTNGAVHVTDFTNASRTMLFDIEKLEWDEKLLQALDIPRAMLPEVRSSSEVYGYTHT
ISGQEVGIPIAGIAGDQQAALFGQMCVESGQAKNTYGTGCFLLMNTGKKIVRSEHGLLTT
IACGASGEVNYALEGAVFNGGSCVQWLRDELKVIKNAKDSELYATRVKDNNGVYVVPAFT
GLGAPYWDPTARGAIFGLTRGASIEHIIRATLESIAFQTRDVLDAMQQDAEEELRTLRVD
GGVTENNFLMQFQADILTTPVERPIMKETTALGAAFLAGLATGFWQDLHELRNKSAIEKV
FEPKMPYEQAELIYKGWLKAVKRSQNWAED
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggaaatttgggcaactcaaagtgctgtatgggtcgaagcattggctcaagctggcata
aagagtgaacaagttgcggcaattggaattacaaaccaacgggaaaccactattgtctgg
gacaaaaaaacaggaaggcctatttacaatgcgattgtttggcaaagccgacaaacaacg
gaaatatgcaatcaattgtataaagcaggttggcaagaatatatccgtaagaccaccggt
ttagtcattgatccatatttctcggccacaaaaattaaatggattttggatcatgttgaa
ggcagccgtgagcgtgctgagcggggagagttattattcggtacggtggatacttggctc
atttggaaactaactaatggtgccgtccatgtcactgattttaccaatgcatctcgaacc
atgctgtttgatatcgaaaagcttgagtgggatgaaaagcttttacaagctttagacatt
cctagagcaatgttgccggaggttcgtagttcatctgaggtttatggatatacacatacc
attagtggacaagaagtagggatcccaattgccggaatcgcgggtgatcagcaggctgcg
ctttttggtcaaatgtgtgttgagtcgggacaggctaaaaatacctacggtaccggctgt
tttctactcatgaatacgggtaaaaagattgtccgttcagagcatggattacttacaact
attgcctgtggtgcgagtggtgaggtgaactatgccttagagggcgccgtatttaacggt
ggttcttgcgtacagtggttacgcgatgaattaaaagttattaagaatgctaaggattcc
gagctttatgcaacacgtgtaaaggataataatggtgtatatgtagtacctgcttttacc
ggattaggagcaccgtattgggacccgacagctcgcggcgcaatttttggtctgacacgt
ggggctagtattgaacatattatccgcgcaactctagagtctatagcctttcaaactcgg
gatgttttagatgccatgcaacaagatgcagaagaagagcttcgtacactccgtgtcgat
ggaggagtaacggaaaataatttcttgatgcaatttcaggccgatattttaacgacaccg
gtagagcgtccaataatgaaagaaactacagcattgggtgcagctttcttagcagggttg
gccactggtttttggcaagatcttcatgagttaagaaataaatctgccatagaaaaagta
tttgaaccgaaaatgccttatgaacaagctgaactcatttataaaggttggctaaaagca
gttaagcgtagtcaaaattgggcagaggattga

DBGET integrated database retrieval system