KEGG   Acinetobacter baumannii ATCC 17978: A1S_2670Help
Entry
A1S_2670          CDS       T00486                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acb00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    A1S_2670
Enzymes [BR:acb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     A1S_2670
Exosome [BR:acb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A1S_2670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3096132..3097484)
Genome map
AA seq 450 aa AA seqDB search
MEIWATQSAVWVEALAQAGIKSEQVAAIGITNQRETTIVWDKKTGRPIYNAIVWQSRQTT
EICNQLYKAGWQEYIRKTTGLVIDPYFSATKIKWILDHVEGSRERAERGELLFGTVDTWL
IWKLTNGAVHVTDFTNASRTMLFDIEKLEWDEKLLQALDIPRAMLPEVRSSSEVYGYTHT
ISGQEVGIPIAGIAGDQQAALFGQMCVESGQAKNTYGTGCFLLMNTGKKIVRSEHGLLTT
IACGASGEVNYALEGAVFNGGSCVQWLRDELKVIKNAKDSELYATRVKDNNGVYVVPAFT
GLGAPYWDPTARGAIFGLTRGASIEHIIRATLESIAFQTRDVLDAMQQDAEEELRTLRVD
GGVTENNFLMQFQADILTTPVERPIMKETTALGAAFLAGLATGFWQDLHELRNKSAIEKV
FEPKMPYEQAELIYKGWLKAVKRSQNWAED
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggaaatttgggcaactcaaagtgctgtatgggtcgaagcattggctcaagctggcata
aagagtgaacaagttgcggcaattggaattacaaaccaacgggaaaccactattgtctgg
gacaaaaaaacaggaaggcctatttacaatgcgattgtttggcaaagccgacaaacaacg
gaaatatgcaatcaattgtataaagcaggttggcaagaatatatccgtaagaccaccggt
ttagtcattgatccatatttctcggccacaaaaattaaatggattttggatcatgttgaa
ggcagccgtgagcgtgctgagcggggagagttattattcggtacggtggatacttggctc
atttggaaactaactaatggtgccgtccatgtcactgattttaccaatgcatctcgaacc
atgctgtttgatatcgaaaagcttgagtgggatgaaaagcttttacaagctttagacatt
cctagagcaatgttgccggaggttcgtagttcatctgaggtttatggatatacacatacc
attagtggacaagaagtagggatcccaattgccggaatcgcgggtgatcagcaggctgcg
ctttttggtcaaatgtgtgttgagtcgggacaggctaaaaatacctacggtaccggctgt
tttctactcatgaatacgggtaaaaagattgtccgttcagagcatggattacttacaact
attgcctgtggtgcgagtggtgaggtgaactatgccttagagggcgccgtatttaacggt
ggttcttgcgtacagtggttacgcgatgaattaaaagttattaagaatgctaaggattcc
gagctttatgcaacacgtgtaaaggataataatggtgtatatgtagtacctgcttttacc
ggattaggagcaccgtattgggacccgacagctcgcggcgcaatttttggtctgacacgt
ggggctagtattgaacatattatccgcgcaactctagagtctatagcctttcaaactcgg
gatgttttagatgccatgcaacaagatgcagaagaagagcttcgtacactccgtgtcgat
ggaggagtaacggaaaataatttcttgatgcaatttcaggccgatattttaacgacaccg
gtagagcgtccaataatgaaagaaactacagcattgggtgcagctttcttagcagggttg
gccactggtttttggcaagatcttcatgagttaagaaataaatctgccatagaaaaagta
tttgaaccgaaaatgccttatgaacaagctgaactcatttataaaggttggctaaaagca
gttaagcgtagtcaaaattgggcagaggattga

DBGET integrated database retrieval system