KEGG   Acinetobacter baumannii ATCC 17978: A1S_2677Help
Entry
A1S_2677          CDS       T00486                                 

Definition
twin-arginine translocation pathway signal
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:acb00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:acb00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:acb02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3102089..3103573)
Genome map
AA seq 494 aa AA seqDB search
MVETSKTDDFTVKVDAAGLQADTVYYYRFKFGNKVSPVGQTKTLPTSTNKVSFAVCSCSN
YPAGYFYVYREMAKQNVDVIIHLGDYIYEYGADGYATEDAIKLGRNLPADNNKEIIKLDD
YRKRYALYRQDKDLKAAHQRHPFIVIWDDHELANDAWREGAENHQSNEGAFSDRKLAALQ
AYFEWMPIRPVSSTDHLNIYRQFNFGSLVQLTMLDTRIIARDKQLAYADYMTTTGLDIAK
FQADLTNPVRTLMGYMQRDWLVDKLKQSTATWNVVGQQVLMSKMWIPAELLASLGQITSG
GTSPDALAKMNAQITELVALKLRLQQNDPTLTAQEKARIMTVAPYNLDAWDGYYAEREFV
YDKLAEFNKKIIVLAGDTHNAWASYLYSQKGKYVGVELATSSVSSPGLEKYLSIPLAQLQ
QFEFAFTTLIDELVYCNLNQRGYLLVTLDQAQVHSEWRFVDSIKNAEYQIDSSRQKDIVL
DLNLMPLKQGQKTA
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggttgaaacaagcaagactgatgactttacagtgaaagttgatgcagctgggttacaa
gcagatacggtgtactactaccgttttaaatttggtaataaagtttcaccagttgggcag
acgaaaacattaccaacatccaccaataaagtgagctttgcagtatgttcttgttctaac
tatcctgcgggttacttttatgtttatcgtgaaatggcaaaacagaatgttgatgtcatt
attcacttgggtgactatatttatgaatatggggcagatggctatgcgacagaagatgca
atcaagctaggccgtaatttacctgccgataataataaagaaattattaaattagatgat
taccgcaaacgttatgcgctttatcgtcaagataaagatttgaaagcagctcatcagcgc
catccttttattgtgatttgggatgaccatgagttggcaaatgatgcttggcgtgagggg
gcggaaaaccatcaaagtaatgaaggggccttttcggaccgtaaattagctgctctacag
gcttattttgaatggatgccaattcgtccagtttctagtacagatcatttaaatatttat
cgccagtttaattttggctctcttgttcagttaaccatgctagatacgcgtattattgcg
cgtgataagcagcttgcatatgcagactacatgacgactacaggtttggatattgcaaag
tttcaggcagatttaactaatccggtgcgtactttgatggggtatatgcaaagagattgg
ttggttgataaattaaagcaatctacagcaacatggaatgtagtagggcagcaagtttta
atgagtaaaatgtggattccagctgagttgttggcgtctttagggcaaattacttcagga
ggaacttcgcctgatgcgcttgctaagatgaatgcacaaattaccgagttggtcgcttta
aaacttcgtttacaacaaaatgatccgacattaacagcccaagaaaaagcaagaattatg
acggttgcgccatataatctcgatgcttgggatggttactatgctgagcgagagtttgtg
tacgataaattggcagaatttaataaaaagatcattgtgttagccggggatacacataat
gcatgggcatcttatttatatagtcagaaagggaaatatgttggagttgaattagcgacc
agttctgtatcgtctccaggtttagaaaaatatttaagtattccactggctcagcttcaa
cagtttgaatttgcatttactacattaattgatgaattggtttattgtaatttaaatcaa
cgaggatatctgttggttactctagatcaggcgcaagttcattctgagtggagatttgta
gattcaattaaaaatgctgaatatcaaatcgattcaagtagacaaaaagatattgtattg
gatctgaatttgatgccgttaaaacaaggtcaaaagacggcttaa

DBGET integrated database retrieval system