KEGG   Acinetobacter baumannii ATCC 17978: A1S_2712Help
Entry
A1S_2712          CDS       T00486                                 

Definition
succinate dehydrogenase hydrophobic subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:acb01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:acb00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:acb00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:acb00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3145288..3145587
Genome map
AA seq 99 aa AA seqDB search
MVLAAYTVVLFGWILCKGGFDYQQWAGFMMTLPMKIFSLLAILSLIAHAWIGMWQVFTDY
VTTRQMGPSAKGLRLVLTTAVIIAVFVYAIWGIQIFWAN
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
gtggtattggcagcttatactgttgttctttttggttggatcctctgcaaaggcggattt
gactatcaacaatgggctggcttcatgatgacattaccaatgaagattttctctttattg
gcaattttgtcgcttatcgcacacgcatggattggtatgtggcaggtttttactgactat
gtcactactcgtcaaatgggtccttcagcgaaaggtttacgccttgtactgactacggct
gtcattattgcagtgtttgtgtacgcaatctggggtatccagattttctgggcgaattga

DBGET integrated database retrieval system