KEGG   Acinetobacter baumannii ATCC 17978: A1S_2716Help
Entry
A1S_2716          CDS       T00486                                 

Definition
dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex (E2)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:acb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A1S_2716
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A1S_2716
  Amino acid metabolism
   00310 Lysine degradation
    A1S_2716
Enzymes [BR:acb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     A1S_2716
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3151646..3152767
Genome map
AA seq 373 aa AA seqDB search
MGEPVSRDEVICDIETDKVVLEVVAPADGSLVAIIKGEGDTVLSDEVIAQFEAGAGAAAA
APAAVEQAVAQTQAGAAPVVERNETVSDQAPAVRKALTESGIAASDVQGTGRGGRITKED
VANHQAKPAANVTPLSVAVGERIEKRVPMTRLRKRVAERLLAATQETAMLTTFNEVNMKP
IMELRKQYKDAFEKRHGARLGFMSFFVKAATEALKRYPAVNASIDGDDIVYHGYYDIGVA
VSSDRGLVVPVLRDTDRMSYAEVEAGIAAYAAKARDGKLSIEEMTGGTFTITNGGTFGSL
LSTPILNQPQTGILGMHKIQERPMAVNGQVEILPMMYLALSYDHRMIDGKEAVGFLVAIK
ELLEEPAKLILDL
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgaacctgtatcacgtgatgaagtaatctgtgatattgaaaccgacaaagttgtt
ttagaagttgttgctcctgcagatggtagcttggttgcaatcattaaaggtgaaggcgat
acagttctttctgacgaagttattgctcaattcgaagctggtgctggcgcagcggctgct
gctcctgcggcagtagaacaagcagttgctcagactcaagctggtgctgctcctgttgtt
gagcgtaacgaaactgtatctgatcaagctcctgcagtacgtaaagcgttaactgaatct
ggcattgctgcttctgacgtacaaggtactggtcgtggtggtcgtatcactaaagaagat
gttgcgaaccatcaagctaaaccagctgctaacgttactccattaagcgttgctgttggc
gaacgtatcgaaaaacgcgttccaatgactcgtttacgtaaacgtgtagctgagcgtctt
cttgcagctactcaagaaacagcaatgttaactacatttaacgaagttaacatgaagcca
atcatggaattacgtaagcaatataaagatgctttcgaaaaacgtcatggtgctcgttta
ggcttcatgtcattcttcgttaaagcagcaactgaagcgcttaaacgctacccagctgta
aatgcttcaattgatggcgatgatatcgtttatcacggttactacgacatcggtgttgca
gtatcttctgatcgtggtcttgttgtaccagtattacgtgatactgaccgtatgagctat
gcagaagttgaagcaggtattgctgcttacgctgctaaagcacgtgatggtaaattatct
atcgaagaaatgactggcggtactttcacaatcactaacggtggtactttcggttcatta
ctttcaactccaattttgaaccagccgcaaactggtatcttgggtatgcataaaatccaa
gaacgtcctatggcggtaaatggtcaagttgaaatcttgccaatgatgtacttagcgctt
tcttatgaccaccgtatgatcgatggtaaagaagctgtaggtttcttagtagcaatcaaa
gaattgttagaagaaccagctaaactcattcttgatctttaa

DBGET integrated database retrieval system