KEGG   Acinetobacter baumannii ATCC 17978: A1S_2810Help
Entry
A1S_2810          CDS       T00486                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:acb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    A1S_2810
  Amino acid metabolism
   00300 Lysine biosynthesis
    A1S_2810
Enzymes [BR:acb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     A1S_2810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3250932..3251981
Genome map
AA seq 349 aa AA seqDB search
MADRLAKVGFHIEPMRFGDVDNLWARRGTEGPVFCFAGHTDVVPTGRLDAWNSDPFAPEI
RDGKLYGRGSADMKTALAAMVVASERFVAKHPNHKGSIAFLITSDEEGPAVNGTVKVIET
LEKRNEKITWCLVGEPSSTHKLGDIVKNGRRGSLNAVLKVQGKQGHVAYPHLARNPIHEA
SPALAELCQTVWDNGNEYFPATSFQISNIHAGTGATNVIPGALEVTFNFRYSTEVTAEQL
KQRVHEILDKHGLQYEIVWNLSGLPFLTPVGELVNAAQTAILNVTGTETELSTSGGTSDG
RFIAPTGAQVLELGVLNATIHQINEHVDVHDLDPLTDIYEQILENLLAQ
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggctgaccgcttagctaaagttggcttccatattgaacctatgcgctttggagatgtc
gataatttatgggctcgacgtggaaccgaaggccctgtattttgttttgctggtcatacc
gacgtagtaccaacaggacgtttagacgcttggaattcagacccatttgcaccagaaatt
cgtgacggcaaattatatggtcgtggttcagcagatatgaaaactgcattagctgcaatg
gtagttgcatctgaacgttttgtagcgaaacacccaaaccataaaggttcaattgctttt
ttaattacttcagatgaagaaggtcctgctgttaacggtacagttaaagtcatcgaaaca
ctggaaaagcgtaatgaaaaaattacttggtgtttggttggtgaaccatcaagtactcat
aaattaggtgatattgttaagaatggccgtcgtggctctcttaatgctgtattgaaggtt
caaggcaaacaaggtcatgtagcttacccacacttggcacggaatccaattcatgaagca
tctccagcgttagctgagttgtgccaaacagtttgggacaatggcaatgagtatttccct
gcaacttcattccagatttcaaatatccatgcaggtactggcgcaaccaatgtgatccct
ggtgctttagaagttacttttaatttccgttattcaaccgaggttacagcagaacagctt
aaacaacgtgttcatgaaattttagacaagcatggcttgcagtatgaaattgtctggaat
ttgtctggcttaccattcttaactccagtaggtgaattagttaacgcagctcaaactgct
attttaaatgtgactggtactgagactgagctttcaacaagtggtggtacatctgatggg
cgcttcattgctccaacaggtgcacaagttttagaactcggtgttctaaacgctactatc
catcaaattaatgaacatgttgatgtacatgatcttgatccattaactgatatttatgag
caaattttagaaaatttattagctcaataa

DBGET integrated database retrieval system